CATH Domain: 3ek1B01 XML data for domain: 3ek1B01

Molscript image for 3ek1B01
3ek1B01
PDB coordinates for domain 3ek1B01

PDB 3ek1, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.605 Aldehyde Dehydrogenase; Chain A, domain 1
3.40.605.10 Aldehyde Dehydrogenase; Chain A, domain 1 Gene3D
3.40.605.10.7
3.40.605.10.7.2
3.40.605.10.7.2.1
3.40.605.10.7.2.1.1
3.40.605.10.7.2.1.1.2

[top]
Segment boundaries for domain 3ek1B01

Chopping figure for domain 3ek1B01
DomainStart PDB ResidueStop PDB Residue
3ek1B01 1 258
3ek1B01 447 483
3ek1B02 259 446

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.40.605.10.7.2.1.1.2 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1t90A01 90.60 Methylmalonate semialdehyde dehydrogenase [acylating]Bacillus subtilisMethylmalonate-semialdehyde dehydrogenase [EC:1.2.1.27]Valine, leucine and isoleucine degradationPropanoate metabolism 3.40.605.10 280 30 95 2.13 2.23
1a4sA01 88.52 Betaine aldehyde dehydrogenaseGadus callarias 3.40.605.10 260 31 85 1.86 2.17
1uxtA01 88.38 Thermoproteus tenaxGlyceraldehyde-3-phosphate dehydrogenase (NADP+) 3.40.605.10 273 26 92 1.99 2.15
1ez0B01 86.27 NADP-dependent fatty aldehyde dehydrogenaseVibrio harveyi 3.40.605.10 312 21 85 2.08 2.43
1ad3A01 82.52 Tyrosine metabolismRattus norvegicusResponse to glucocorticoid stimulus3-chloroallyl aldehyde dehydrogenase activityCytosol 3.40.605.10 247 21 79 2.27 2.86
1o20A01 81.29 Thermotoga maritimaGamma-glutamyl phosphate reductaseArginine and proline metabolismGlutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]Metabolic pathways 3.40.605.10 263 14 81 3.62 4.43
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3ek1B01
MLALKDPSLLKSQCLVNGRWIDAADGTTIKVTNPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKW
FDLIIANADDIALIMTSEQGKPLAEARGEVLYAASFIEWFAEEAKRVYGDTIPAPQNGQRLTVIRQPVGVTAAITPWNFP
AAMITRKAAPALAAGCTMIVRPADLTPLTALALGVLAEKAGIPAGVLQIVTGKAREIGAELTSNDTVRKLSFTGSTEVGR
LLMAQCAPTIKRISLELGEVAPFGGVKQSGLGREGSKYGIEEYLETKYICSAYKR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3ek1B01
MLALKDPSLLKSQCLVNGRWIDAADGTTIKVTNPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKW
FDLIIANADDIALIMTSEQGKPLAEARGEVLYAASFIEWFAEEAKRVYGDTIPAPQNGQRLTVIRQPVGVTAAITPWNFP
AAMITRKAAPALAAGCTMIVRPADLTPLTALALGVLAEKAGIPAGVLQIVTGKAREIGAELTSNDTVRKLSFTGSTEVGR
LLMAQCAPTIKRISLELGEVAPFGGVKQSGLGREGSKYGIEEYLETKYICSAYKR
BLAST against CATH

[top]
Domain History Events (14)

Domain assigned by auto on 06 Oct 2008 17:56

Assigning to "3.40.605.10" based on similarity with "3ek1D01"

Flow stage update by auto on 06 Oct 2008 17:56

No in_process hits for Domain "3ek1B01" ready to be processed

Update comment by auto on 06 Oct 2008 17:54

Domain "3ek1B01" hits Domain "3ek1G01" (100% over 99.6610169491525%) which is currently in process

Update comment by auto on 06 Oct 2008 17:52

Domain "3ek1B01" hits Domain "3ek1H01" (100% over 100%) which is currently in process

Update comment by auto on 06 Oct 2008 17:50

Domain "3ek1B01" hits Domain "3ek1F01" (100% over 100%) which is currently in process

Update comment by auto on 06 Oct 2008 17:48

Domain "3ek1B01" hits Domain "3ek1E01" (100% over 100%) which is currently in process

Update comment by auto on 06 Oct 2008 17:46

Domain "3ek1B01" hits Domain "3ek1D01" (100% over 100%) which is currently in process

Update comment by auto on 06 Oct 2008 17:44

Domain "3ek1B01" hits Domain "3ek1A01" (100% over 99.3265993265993%) which is currently in process

Update comment by auto on 06 Oct 2008 14:31

Domain "3ek1B01" hits Domain "3ek1C01" (100% over 100%) which is currently in process

Flow stage update by auto on 06 Oct 2008 14:18

Domain "3ek1B01" hits Domain "3ek1C01" (100% over 100%) which is currently in process

Flow stage update by auto on 06 Oct 2008 14:18

NW result present for Domain "3ek1B01"

Flow stage update by auto on 05 Oct 2008 08:19

All required files are present for Domain "3ek1B01"

Flow stage update by auto on 04 Oct 2008 23:37

Beginning processing for Domain "3ek1B01"

Insertion by auto on 04 Oct 2008 23:11

Final ChopClose added based on similarity with "3ek1C"