CATH Domain: 3eerA02 XML data for domain: 3eerA02

Molscript image for 3eerA02
3eerA02
PDB coordinates for domain 3eerA02

PDB 3eer, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.300 GMP Synthetase; Chain A, domain 3
3.30.300.20 Gene3D
3.30.300.20.1
3.30.300.20.1.1
3.30.300.20.1.1.1
3.30.300.20.1.1.1.1
3.30.300.20.1.1.1.1.1

[top]
Segment boundaries for domain 3eerA02

Chopping figure for domain 3eerA02
DomainStart PDB ResidueStop PDB Residue
3eerA01 7 48
3eerA02 49 145

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.30.300.20.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1lqlA02 87.93 Mycoplasma pneumoniaeUncharacterized protein MG427 homolog 3.30.300.20 103 18 92 2.77 3.00
1ukkA00 81.32 Osmotically inducible protein CThermus thermophilus 3.30.300.20 136 21 66 2.37 3.54
1vlaA02 81.27 Putative redox proteinThermotoga maritimaPutative uncharacterized protein 3.30.300.20 98 5 85 3.55 4.14
2onfA01 80.59 Thermoplasma acidophilumPutative uncharacterized protein Ta0195 3.30.300.20 123 21 69 2.51 3.59
2d7vB00 79.94 Vibrio choleraePutative uncharacterized protein 3.30.300.20 151 19 58 1.73 2.97
2pn2A00 77.36 Psychrobacter arcticus 273-4Putative uncharacterized protein 3.30.300.20 129 15 65 2.32 3.56
2oplB01 77.15 Geobacter sulfurreducensPutative uncharacterized protein 3.30.300.20 154 16 51 2.42 4.72
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3eerA02
NPEQLFAVGYAACFSNAILHVAREAKVALKEAPVTATVGIGPNGQGGFALSVALAAHIALEDEQARQLVTVAHQVCPYSN
AVRGNIDVQVSVNGLAL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3eerA02
NPEQLFAVGYAACFSNAILHVAREAKVALKEAPVTATVGIGPNGQGGFALSVALAAHIALEDEQARQLVTVAHQVCPYSN
AVRGNIDVQVSVNGLAL
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 28 Oct 2008 14:36

Assigning to "3.30.300.20" based on similarity with "1n2fA02"

Flow stage update by auto on 28 Oct 2008 14:15

No in_process hits for Domain "3eerA02" ready to be processed

Flow stage update by auto on 28 Oct 2008 14:15

NW result present for Domain "3eerA02"

Flow stage update by auto on 26 Oct 2008 08:20

All required files are present for Domain "3eerA02"

Flow stage update by auto on 25 Oct 2008 14:08

Beginning processing for Domain "3eerA02"

Insertion by auto on 25 Oct 2008 14:07

Final ChopClose added based on similarity with "1n2fA"