CATH Domain: 3eerA01 XML data for domain: 3eerA01

Molscript image for 3eerA01
3eerA01
PDB coordinates for domain 3eerA01

PDB 3eer, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.25 N-terminal domain of TfIIb
2.20.25.10 Gene3D
2.20.25.10.1
2.20.25.10.1.1
2.20.25.10.1.1.1
2.20.25.10.1.1.1.2
2.20.25.10.1.1.1.2.1

[top]
Segment boundaries for domain 3eerA01

Chopping figure for domain 3eerA01
DomainStart PDB ResidueStop PDB Residue
3eerA01 7 48
3eerA02 49 145

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.20.25.10.1.1.1.2.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1zb9A01 84.96 Organic hydroperoxide resistance proteinXylella fastidiosa 2.20.25.10 47 32 87 1.85 2.12
1vlaA01 67.63 Putative redox proteinThermotoga maritimaPutative uncharacterized protein 2.20.25.10 38 15 73 3.33 4.51
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3eerA01
STIYQTSATASAGRNGVVSTEDKLLELNLSYPKEGGSGTAT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3eerA01
SNAMRNKNXSTIYQTSATASAGRNGVVSTEDKLLELNLSYPKEXGGSGTAT
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 28 Oct 2008 14:36

Assigning to "2.20.25.10" based on similarity with "1uspA01"

Flow stage update by auto on 28 Oct 2008 14:15

No in_process hits for Domain "3eerA01" ready to be processed

Flow stage update by auto on 28 Oct 2008 14:15

NW result present for Domain "3eerA01"

Flow stage update by auto on 26 Oct 2008 08:20

All required files are present for Domain "3eerA01"

Flow stage update by auto on 25 Oct 2008 14:08

Beginning processing for Domain "3eerA01"

Insertion by auto on 25 Oct 2008 14:07

Final ChopClose added based on similarity with "1n2fA"