CATH Domain: 3e9bA00 XML data for domain: 3e9bA00

Molscript image for 3e9bA00
3e9bA00
PDB coordinates for domain 3e9bA00

PDB 3e9b, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.800 Arginase; Chain A
3.40.800.10 Gene3D
3.40.800.10.1
3.40.800.10.1.1
3.40.800.10.1.1.2
3.40.800.10.1.1.2.12
3.40.800.10.1.1.2.12.1

[top]
Segment boundaries for domain 3e9bA00

Chopping figure for domain 3e9bA00
DomainStart PDB ResidueStop PDB Residue
3e9bA00 6 313

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.800.10.1.1.2.12.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gq6B00 86.00 Streptomyces clavuligerusProclavaminate amidinohydrolase 3.40.800.10 301 24 87 3.20 3.68
1wohA00 84.86 Agmatinase, putativeAgmatinase [EC:3.5.3.11]Arginine and proline metabolismDeinococcus radioduransMetabolic pathways 3.40.800.10 303 22 85 3.16 3.71
1xfkA00 82.74 Histidine metabolismMetabolic pathwaysFormiminoglutamase [EC:3.5.3.8]Vibrio choleraeFormimidoylglutamase 3.40.800.10 324 17 84 3.69 4.35
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3e9bA00
KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVA
ETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTASSGNLHGQPVAFLLKELKGKFPDVPGFSWV
TPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATG
TPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3e9bA00
MSSKPKPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQL
AAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTASSGNLHGQPVAFLLKELKGKFPDVP
GFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVF
TPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYLK
PPK
BLAST against CATH

[top]
Domain History Events (18)

Domain assigned by auto on 16 Dec 2008 09:30

Assigning to "3.40.800.10" based on similarity with "3e8qA00"

Flow stage update by auto on 16 Dec 2008 09:30

No in_process hits for Domain "3e9bA00" ready to be processed

Update comment by auto on 16 Dec 2008 09:02

Domain "3e9bA00" hits Domain "3e9bC00" (100% over 100%) which is currently in process

Update comment by auto on 16 Dec 2008 08:11

Domain "3e9bA00" hits Domain "3e8qC00" (100% over 100%) which is currently in process

Update comment by auto on 16 Dec 2008 07:31

Domain "3e9bA00" hits Domain "3e8qB00" (100% over 100%) which is currently in process

Update comment by auto on 16 Dec 2008 07:03

Domain "3e9bA00" hits Domain "3e8qA00" (100% over 100%) which is currently in process

Update comment by auto on 16 Dec 2008 06:39

Domain "3e9bA00" hits Domain "3e8zA00" (99.3808049535604% over 100%) which is currently in process

Update comment by auto on 16 Dec 2008 06:01

Domain "3e9bA00" hits Domain "3e8zC00" (99.3808049535604% over 100%) which is currently in process

Update comment by auto on 16 Dec 2008 04:55

Domain "3e9bA00" hits Domain "3e8zB00" (99.3808049535604% over 100%) which is currently in process

Update comment by auto on 16 Dec 2008 03:43

Domain "3e9bA00" hits Domain "3e6vA00" (86.6459627329193% over 99.6904024767802%) which is currently in process

Update comment by auto on 16 Dec 2008 02:40

Domain "3e9bA00" hits Domain "3e6vB00" (86.6459627329193% over 99.6904024767802%) which is currently in process

Update comment by auto on 16 Dec 2008 01:14

Domain "3e9bA00" hits Domain "3e6kB00" (86.6459627329193% over 99.6904024767802%) which is currently in process

Update comment by auto on 15 Dec 2008 20:38

Domain "3e9bA00" hits Domain "3e6kA00" (86.6459627329193% over 99.6904024767802%) which is currently in process

Flow stage update by auto on 15 Dec 2008 20:17

Domain "3e9bA00" hits Domain "3e6kA00" (86.6459627329193% over 99.6904024767802%) which is currently in process

Flow stage update by auto on 15 Dec 2008 20:17

NW result present for Domain "3e9bA00"

Flow stage update by auto on 10 Dec 2008 14:17

All required files are present for Domain "3e9bA00"

Flow stage update by auto on 10 Dec 2008 14:15

Beginning processing for Domain "3e9bA00"

Insertion by auto on 08 Dec 2008 11:50

Final ChopClose added based on similarity with "3e8qA"