CATH Domain: 3e2oA02 XML data for domain: 3e2oA02

Molscript image for 3e2oA02
3e2oA02
PDB coordinates for domain 3e2oA02

PDB 3e2o, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.420 Peroxidase; domain 2
1.10.420.10 Peroxidase, domain 2 Gene3D
1.10.420.10.1
1.10.420.10.1.1
1.10.420.10.1.1.1
1.10.420.10.1.1.1.1
1.10.420.10.1.1.1.1.1

[top]
Segment boundaries for domain 3e2oA02

Chopping figure for domain 3e2oA02
DomainStart PDB ResidueStop PDB Residue
3e2oA01 4 144
3e2oA01 266 294
3e2oA02 145 265

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 1.10.420.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1iynA02 91.26 Stromal ascorbate peroxidaseNicotiana tabacum 1.10.420.10 124 32 85 1.02 1.19
2ccaA02 90.38 Methane metabolismPhenylalanine metabolismTryptophan metabolismMetabolic pathwaysCatalase/peroxidase [EC:1.11.1.6 1.11.1.7] 1.10.420.10 133 32 87 1.08 1.24
1bgpA02 86.05 Hordeum vulgarePeroxidase BP 1 1.10.420.10 136 19 72 1.53 2.10
1mwvA04 84.74 Catalase/peroxidase [EC:1.11.1.6 1.11.1.7]Burkholderia pseudomalleiMethane metabolismCatalase-peroxidaseMetabolic pathways 1.10.420.10 123 15 86 3.08 3.57
1gwuA02 84.56 Armoracia rusticanaPeroxidase C1A 1.10.420.10 146 18 67 1.57 2.32
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3e2oA02
PDADKDADYVRTFFQRLNMNDREVVALMGAHALGKTHLKRSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWD
SKSGYMMLPTXYSLIQDPKYLSIVKEYANDQDKFFKDFSKA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3e2oA02
PDADKDADYVRTFFQRLNMNDREVVALMGAHALGKTHLKRSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWD
SKSGYMMLPTXYSLIQDPKYLSIVKEYANDQDKFFKDFSKA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 28 Oct 2008 11:29

Assigning to "1.10.420.10" based on similarity with "1cyp002"

Flow stage update by auto on 28 Oct 2008 11:09

No in_process hits for Domain "3e2oA02" ready to be processed

Flow stage update by auto on 28 Oct 2008 11:09

NW result present for Domain "3e2oA02"

Flow stage update by auto on 26 Oct 2008 08:20

All required files are present for Domain "3e2oA02"

Flow stage update by auto on 25 Oct 2008 11:33

Beginning processing for Domain "3e2oA02"

Insertion by auto on 25 Oct 2008 11:11

Final ChopClose added based on similarity with "1kokA"