CATH Domain: 3e2oA01 XML data for domain: 3e2oA01

Molscript image for 3e2oA01
3e2oA01
PDB coordinates for domain 3e2oA01

PDB 3e2o, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.520 Peroxidase; domain 1
1.10.520.10 Gene3D
1.10.520.10.1
1.10.520.10.1.1
1.10.520.10.1.1.1
1.10.520.10.1.1.1.1
1.10.520.10.1.1.1.1.1

[top]
Segment boundaries for domain 3e2oA01

Chopping figure for domain 3e2oA01
DomainStart PDB ResidueStop PDB Residue
3e2oA01 4 144
3e2oA01 266 294
3e2oA02 145 265

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.10.520.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2vcnA01 89.10 Ascorbate peroxidaseGlycine max 1.10.520.10 141 34 83 2.53 3.03
1itkA01 86.80 Haloarcula marismortuiCatalase-peroxidase 2 1.10.520.10 142 29 81 1.93 2.36
1yydA01 85.09 Phanerochaete chrysosporiumManganese peroxidase 1 1.10.520.10 159 16 91 3.58 3.93
1mwvA03 84.22 Catalase/peroxidase [EC:1.11.1.6 1.11.1.7]Burkholderia pseudomalleiMethane metabolismCatalase-peroxidasePhenylalanine metabolism 1.10.520.10 181 17 79 2.85 3.61
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3e2oA01
LVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFNDPSNA
GLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLFEKLLENGITFPKDAPSPF
IFKTLEEQGL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3e2oA01
TTPLVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFNDP
SNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLFEKLLENGITFPKDAP
SPFIFKTLEEQGL
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 28 Oct 2008 11:29

Assigning to "1.10.520.10" based on similarity with "1stqA01"

Flow stage update by auto on 28 Oct 2008 11:09

No in_process hits for Domain "3e2oA01" ready to be processed

Flow stage update by auto on 28 Oct 2008 11:09

NW result present for Domain "3e2oA01"

Flow stage update by auto on 26 Oct 2008 08:20

All required files are present for Domain "3e2oA01"

Flow stage update by auto on 25 Oct 2008 11:33

Beginning processing for Domain "3e2oA01"

Insertion by auto on 25 Oct 2008 11:11

Final ChopClose added based on similarity with "1kokA"