Domain assigned by auto on 27 Aug 2008 17:23
Assigning to "3.90.1150.10" based on similarity with "1bw0A01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3dydA01 | 64 | 90 |
| 3dydA01 | 335 | 444 |
| 3dydA02 | 91 | 334 |
There are 13 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.26.1.1.1.1 (SIMAX score < 5)
>pdb|3dydA01 KVKPNPNKTMISLSIGDPTVFGNLPTDPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFPEFE NDVEFTERLVAEQSVHCLPATCFEYPNFIRVVITVPEVMMLEACSRIQEFCEQHYHC
Assigning to "3.90.1150.10" based on similarity with "1bw0A01"
No in_process hits for Domain "3dydA01" ready to be processed
NW result present for Domain "3dydA01"
All required files are present for Domain "3dydA01"
Beginning processing for Domain "3dydA01"
Final ChopClose added based on similarity with "1bw0A"