CATH Domain: 3djhA00 XML data for domain: 3djhA00

Molscript image for 3djhA00
3djhA00
PDB coordinates for domain 3djhA00

PDB 3djh, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.429 Macrophage Migration Inhibitory Factor
3.30.429.10 Macrophage Migration Inhibitory Factor Gene3D
3.30.429.10.1
3.30.429.10.1.1
3.30.429.10.1.1.1
3.30.429.10.1.1.1.1
3.30.429.10.1.1.1.1.1

[top]
Segment boundaries for domain 3djhA00

Chopping figure for domain 3djhA00
DomainStart PDB ResidueStop PDB Residue
3djhA00 1 114

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.429.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2xczA00 94.85 Possible ATLS1-like light-inducible proteinProchlorococcus marinus str. MIT 9313 3.30.429.10 114 34 100 1.26 1.26
1dptA00 92.64 D-dopachrome decarboxylaseDopachrome isomerase activityHomo sapiensD-dopachrome decarboxylase [EC:4.1.1.84]Protein binding 3.30.429.10 117 32 97 1.18 1.21
1mwwB00 85.12 Haemophilus influenzaeUncharacterized protein HI_1388.1 3.30.429.10 118 14 95 2.60 2.72
1u9dA00 83.63 Vibrio choleraePutative uncharacterized protein 3.30.429.10 120 6 87 2.74 3.13
3c6vA00 78.92 Aspergillus fumigatusPutative uncharacterized protein 3.30.429.10 140 12 78 3.47 4.42
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3djhA00
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLC
GLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3djhA00
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLC
GLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
BLAST against CATH

[top]
Domain History Events (13)

Domain assigned by auto on 10 Jan 2009 18:10

Assigning to "3.30.429.10" based on similarity with "3djhB00"

Flow stage update by auto on 10 Jan 2009 18:09

No in_process hits for Domain "3djhA00" ready to be processed

Update comment by auto on 10 Jan 2009 18:07

Domain "3djhA00" hits Domain "3djiA00" (100% over 100%) which is currently in process

Update comment by auto on 10 Jan 2009 18:04

Domain "3djhA00" hits Domain "3djhB00" (100% over 100%) which is currently in process

Update comment by auto on 10 Jan 2009 18:01

Domain "3djhA00" hits Domain "3djhC00" (100% over 100%) which is currently in process

Update comment by auto on 10 Jan 2009 17:57

Domain "3djhA00" hits Domain "3ce4B00" (100% over 100%) which is currently in process

Update comment by auto on 10 Jan 2009 17:54

Domain "3djhA00" hits Domain "3ce4A00" (100% over 100%) which is currently in process

Update comment by auto on 10 Jan 2009 17:46

Domain "3djhA00" hits Domain "3ce4C00" (100% over 100%) which is currently in process

Flow stage update by auto on 10 Jan 2009 17:30

Domain "3djhA00" hits Domain "3ce4C00" (100% over 100%) which is currently in process

Flow stage update by auto on 10 Jan 2009 17:30

NW result present for Domain "3djhA00"

Flow stage update by auto on 07 Jan 2009 10:18

All required files are present for Domain "3djhA00"

Flow stage update by auto on 06 Jan 2009 23:57

Beginning processing for Domain "3djhA00"

Insertion by auto on 06 Jan 2009 23:10

Final ChopClose added based on similarity with "1ca7A"