CATH Domain: 3djbA01 XML data for domain: 3djbA01

Molscript image for 3djbA01
3djbA01
PDB coordinates for domain 3djbA01

PDB 3djb, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.472 Cyclin A; domain 1
1.10.472.50 HD-domain/PDEase-like Gene3D
1.10.472.50.3
1.10.472.50.3.1
1.10.472.50.3.1.1
1.10.472.50.3.1.1.1
1.10.472.50.3.1.1.1.1

Segment boundaries for domain 3djbA01

Chopping figure for domain 3djbA01
DomainStart PDB ResidueStop PDB Residue
3djbA01 2 99
3djbA02 112 214

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.472.50.3.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2pq7A00 76.91 Uncultured Thermotogales bacteriumPredicted HD superfamily hydrolase 1.10.3210.10 168 22 53 2.36 4.41
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|3djbA01
TKQEKIEKTITFVKHILEKDASGHDWYHIRRVHKAISLSEQEGGNRFIIEAALLHDVADLNESEEAGKKVSDWLEELHVE
EEESKHVLHIIAN    

Domain COMBS Sequence

>pdb|3djbA01
XTKQEKIEKTITFVKHILEKDASGHDWYHIRRVHKXAISLSEQEGGNRFIIEXAALLHDVADEKLNESEEAGXKKVSDWL
EELHVEEEESKHVLHIIAN    

Domain History Events (6)

Domain assigned by auto on 27 Aug 2008 11:23

Assigning to "1.10.472.50" based on similarity with "3b57A01"

Flow stage update by auto on 27 Aug 2008 11:07

No in_process hits for Domain "3djbA01" ready to be processed

Flow stage update by auto on 27 Aug 2008 11:07

NW result present for Domain "3djbA01"

Flow stage update by auto on 26 Aug 2008 08:10

All required files are present for Domain "3djbA01"

Flow stage update by auto on 25 Aug 2008 11:31

Beginning processing for Domain "3djbA01"

Insertion by auto on 25 Aug 2008 11:18

Final ChopClose added based on similarity with "3b57A"