CATH Domain: 3dfxA00 XML data for domain: 3dfxA00

Molscript image for 3dfxA00
3dfxA00
PDB coordinates for domain 3dfxA00

PDB 3dfx, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.50 Erythroid Transcription Factor GATA-1; Chain A
3.30.50.10 Erythroid Transcription Factor GATA-1, subunit A Gene3D
3.30.50.10.5
3.30.50.10.5.1
3.30.50.10.5.1.1
3.30.50.10.5.1.1.1
3.30.50.10.5.1.1.1.1

[top]
Segment boundaries for domain 3dfxA00

Chopping figure for domain 3dfxA00
DomainStart PDB ResidueStop PDB Residue
3dfxA00 308 365

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.50.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2vutI00 89.07 Nitrogen regulatory protein areASequence-specific DNA bindingGATA-binding protein, other eukaryoteEmericella nidulansProtein binding 3.30.50.10 42 61 72 1.53 2.11
2gviA03 75.86 Putative uncharacterized protein Ta1109Thermoplasma acidophilum 3.30.60.20 32 28 53 2.25 4.21
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3dfxA00
SAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3dfxA00
SAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSS
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 06 Aug 2008 15:44

Assigning to "3.30.50.10" based on similarity with "3dfvC00"

Flow stage update by auto on 06 Aug 2008 15:44

No in_process hits for Domain "3dfxA00" ready to be processed

Update comment by auto on 06 Aug 2008 11:26

Domain "3dfxA00" hits Domain "3dfvC00" (100% over 100%) which is currently in process

Flow stage update by auto on 06 Aug 2008 11:10

Domain "3dfxA00" hits Domain "3dfvC00" (100% over 100%) which is currently in process

Flow stage update by auto on 06 Aug 2008 11:10

NW result present for Domain "3dfxA00"

Flow stage update by auto on 03 Aug 2008 11:10

All required files are present for Domain "3dfxA00"

Flow stage update by auto on 02 Aug 2008 18:09

Beginning processing for Domain "3dfxA00"

Insertion by auto on 02 Aug 2008 17:47

Final ChopClose added based on similarity with "3dfvC"