CATH Domain: 3dfrA00 XML data for domain: 3dfrA00

Molscript image for 3dfrA00
3dfrA00
PDB coordinates for domain 3dfrA00

PDB 3dfr, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.430 Dihydrofolate Reductase, subunit A
3.40.430.10 Dihydrofolate Reductase, subunit A Gene3D
3.40.430.10.6
3.40.430.10.6.1
3.40.430.10.6.1.1
3.40.430.10.6.1.1.1
3.40.430.10.6.1.1.1.1

[top]
Segment boundaries for domain 3dfrA00

Chopping figure for domain 3dfrA00
DomainStart PDB ResidueStop PDB Residue
3dfrA00 1 162

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 3.40.430.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ix9A00 91.00 One carbon pool by folateDihydrofolate reductaseFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3]Metabolic pathways 3.40.430.10 166 32 96 1.67 1.72
1vdrA00 87.49 One carbon pool by folateDihydrofolate reductaseHaloferax volcaniiFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3] 3.40.430.10 157 24 94 1.79 1.90
1qzfA01 86.87 Pyrimidine metabolismThymidylate synthase [EC:2.1.1.45]One carbon pool by folateBifunctional dihydrofolate reductase-thymidylate synthaseFolate biosynthesis 3.40.430.10 176 24 89 1.93 2.15
1cz3B00 86.63 Thermotoga maritimaDihydrofolate reductase 3.40.430.10 168 24 92 2.58 2.80
2bl9A00 85.49 Bifunctional dihydrofolate reductase-thymidylate synthasePlasmodium vivax 3.40.430.10 216 24 73 1.49 2.02
2fziA00 84.93 Pneumocystis cariniiDihydrofolate reductase 3.40.430.10 206 23 77 1.83 2.36
1juvA00 83.40 Dihydrofolate reductaseEnterobacteria phage T4 3.40.430.10 193 18 80 2.45 3.03
2hxvA02 81.10 Riboflavin metabolismMetabolic pathwaysThermotoga maritimaDiaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]Riboflavin-specific deaminase 3.40.430.10 193 12 78 2.88 3.68
2p4gA00 77.26 Corynebacterium diphtheriaePutative uncharacterized protein 3.40.430.10 244 11 63 2.87 4.49
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3dfrA00
TAFLWAQNRNGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTNVVLTHQEDYQAQGAVVVHDVA
AVFAYAKQHLDQELVIAGGAQIFTAFKDDVDTLLVTRLAGSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQK
KA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3dfrA00
TAFLWAQNRNGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTNVVLTHQEDYQAQGAVVVHDVA
AVFAYAKQHLDQELVIAGGAQIFTAFKDDVDTLLVTRLAGSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQK
KA
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "3dfr000" to "3dfrA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:48

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"