Domain assigned by auto on 18 Oct 2008 21:03
Assigning to "2.40.10.10" based on similarity with "3e0pB02"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3dfjA01 | 45 | 56 |
| 3dfjA01 | 153 | 275 |
| 3dfjA02 | 57 | 152 |
| 3dfjA02 | 276 | 292 |
There are 35 matching structural neighberhood comparisons for CATH ID 2.40.10.10.11.1.2.1.1 (SIMAX score < 5)
>pdb|3dfjA02 PWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIA LLQLSRPITFSRYIRPSYASWIQSKVTELQLVP
Assigning to "2.40.10.10" based on similarity with "3e0pB02"
No in_process hits for Domain "3dfjA02" ready to be processed
Domain "3dfjA02" hits Domain "3dflA02" (100% over 85.9375%) which is currently in process
Domain "3dfjA02" hits Domain "2zdmA02" (35.2941176470588% over 79.6875%) which is currently in process
Domain "3dfjA02" hits Domain "2zdnA02" (35.2941176470588% over 79.6875%) which is currently in process
Domain "3dfjA02" hits Domain "2zdnA02" (35.2941176470588% over 79.6875%) which is currently in process
NW result present for Domain "3dfjA02"
All required files are present for Domain "3dfjA02"
Beginning processing for Domain "3dfjA02"
Final ChopClose added based on similarity with "3e0pB"