CATH Domain: 3dfjA01 XML data for domain: 3dfjA01

Molscript image for 3dfjA01
3dfjA01
PDB coordinates for domain 3dfjA01

PDB 3dfj, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.10 Thrombin, subunit H
2.40.10.10 Trypsin-like serine proteases Gene3D
2.40.10.10.50
2.40.10.10.50.1
2.40.10.10.50.1.1
2.40.10.10.50.1.1.2
2.40.10.10.50.1.1.2.1

[top]
Segment boundaries for domain 3dfjA01

Chopping figure for domain 3dfjA01
DomainStart PDB ResidueStop PDB Residue
3dfjA01 45 56
3dfjA01 153 275
3dfjA02 57 152
3dfjA02 276 292

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 2.40.10.10.50.1.1.2.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1q3xA02 88.85 Serine-type endopeptidase activityHomo sapiensMannan-binding lectin serine protease 2Calcium-dependent protein bindingComplement activation, lectin pathway 2.40.10.10 137 34 92 1.93 2.08
2asuB01 88.72 Hepatocyte growth factor-like proteinHomo sapiens 2.40.10.10 122 30 90 2.46 2.73
1si5H01 87.64 Pathways in cancerHepatocyte growth factorEpithelial to mesenchymal transitionRenal cell carcinomaCytokine-cytokine receptor interaction 2.40.10.10 119 27 87 2.02 2.30
2hlcA02 87.61 CollagenaseHypoderma lineatum 2.40.10.10 126 26 89 2.16 2.41
1elvA02 87.48 Serine-type endopeptidase activitySystemic lupus erythematosusComplement C1s subcomponentHomo sapiensComplement component 1, s subcomponent [EC:3.4.21.42] 2.40.10.10 126 29 89 2.35 2.63
1dleB02 79.64 Complement factor BComplement bindingHomo sapiensComponent factor B [EC:3.4.21.47]Complement and coagulation cascades 2.40.10.10 142 18 76 3.15 4.10
1y8tB02 78.79 Two-component systemPutative serine protease PepD [EC:3.4.21.-]PROBABLE SERINE PROTEASE PEPD (SERINE PROTEINASE) (MTB32B)Mycobacterium tuberculosis 2.40.10.10 111 13 68 3.21 4.69
2qf3B02 78.54 Protease degSProtein bindingSerine protease DegS [EC:3.4.21.-]Escherichia coli K-12 2.40.10.10 103 11 67 3.00 4.43
1svpA02 71.41 Sindbis virusStructural polyprotein 2.40.10.10 86 10 52 2.53 4.81
3fanA02 70.19 Porcine reproductive and respiratory syndrome virusNon-structural protein 2.40.10.10 69 14 46 2.28 4.89
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3dfjA01
ITGGSSAVAGQWISLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNALYNIDAKPEEPHFVQED
MVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLAS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3dfjA01
ITGGSSAVAGQWISLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNALYNIDAKPEEPHFVQED
MVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLAS
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 18 Oct 2008 20:49

Assigning to "2.40.10.10" based on similarity with "3e16B01"

Flow stage update by auto on 18 Oct 2008 20:49

No in_process hits for Domain "3dfjA01" ready to be processed

Update comment by auto on 18 Oct 2008 20:29

Domain "3dfjA01" hits Domain "2zdmA01" (47.5% over 88.8888888888889%) which is currently in process

Update comment by auto on 18 Oct 2008 17:29

Domain "3dfjA01" hits Domain "2zdnA01" (47.5% over 88.8888888888889%) which is currently in process

Flow stage update by auto on 18 Oct 2008 17:09

Domain "3dfjA01" hits Domain "2zdnA01" (47.5% over 88.8888888888889%) which is currently in process

Flow stage update by auto on 18 Oct 2008 17:09

NW result present for Domain "3dfjA01"

Flow stage update by auto on 18 Oct 2008 11:11

All required files are present for Domain "3dfjA01"

Flow stage update by auto on 17 Oct 2008 15:08

Beginning processing for Domain "3dfjA01"

Insertion by auto on 17 Oct 2008 14:28

Final ChopClose added based on similarity with "3e0pB"