CATH Domain: 3d9yA00 XML data for domain: 3d9yA00

Molscript image for 3d9yA00
3d9yA00
PDB coordinates for domain 3d9yA00

PDB 3d9y, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.30 Dynein light chain 2a, cytoplasmic Gene3D
3.30.450.30.4
3.30.450.30.4.1
3.30.450.30.4.1.1
3.30.450.30.4.1.1.1
3.30.450.30.4.1.1.1.1

[top]
Segment boundaries for domain 3d9yA00

Chopping figure for domain 3d9yA00
DomainStart PDB ResidueStop PDB Residue
3d9yA00 1 126

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.450.30.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1stzA02 77.54 Thermotoga maritimaHeat-inducible transcription repressor hrcAHeat-inducible transcriptional repressor 3.30.450.40 149 5 63 2.84 4.50
1ifqB00 77.54 SNARE interactions in vesicular transportMus musculusVesicle-trafficking protein SEC22bGolgi membraneEndoplasmic reticulum membrane 3.30.450.50 125 8 68 3.00 4.40
2qybA00 77.10 Membrane protein, putativeGeobacter sulfurreducens 3.30.450.40 147 11 69 2.88 4.15
3kshA00 75.78 GAF domain-containing proteinStaphylococcus aureus subsp. aureus MRSA252Putative uncharacterized protein 3.30.450.40 152 8 69 3.27 4.73
3eeaA00 74.96 GAF domain/HD domain proteinGeobacter sulfurreducens 3.30.450.40 153 7 68 3.32 4.84
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3d9yA00
SWQAYVDTSLLGTGKIDRAAIVSRAGDSVWAASAGFNLSPQEIQGLAAGFQDPPSMFGTGIILAGQKYITIRAEGRSIYG
KLQKEGIICVATKLCILVSHYPETTLPGEAAKITEALADYLVGVGY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3d9yA00
MSWQAYVDTSLLGTGKIDRAAIVSRAGDSVWAASAGFNLSPQEIQGLAAGFQDPPSMFGTGIILAGQKYITIRAEGRSIY
GKLQKEGIICVATKLCILVSHYPETTLPGEAAKITEALADYLVGVGY
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 20 Dec 2008 23:43

Assigning to "3.30.450.30" based on similarity with "1k0kA00"

Flow stage update by auto on 20 Dec 2008 23:13

No in_process hits for Domain "3d9yA00" ready to be processed

Flow stage update by auto on 20 Dec 2008 23:13

NW result present for Domain "3d9yA00"

Flow stage update by auto on 20 Dec 2008 11:18

All required files are present for Domain "3d9yA00"

Flow stage update by auto on 19 Dec 2008 11:17

Beginning processing for Domain "3d9yA00"

Insertion by auto on 19 Dec 2008 11:07

Final ChopClose added based on similarity with "1k0kA"