Domain assigned by auto on 15 Dec 2008 16:36
Assigning to "2.60.40.10" based on similarity with "3hfmL01"
| CATH Code | Level Description | Links |
|---|---|---|
2
| Mainly Beta | |
2.60
| Sandwich | |
2.60.40
| Immunoglobulin-like | |
2.60.40.10
| Immunoglobulins | Gene3D |
2.60.40.10.4
| ||
2.60.40.10.4.1
| ||
2.60.40.10.4.1.1
| ||
2.60.40.10.4.1.1.1
| ||
2.60.40.10.4.1.1.1.1
|
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3d9aL01 | 1 | 108 |
| 3d9aL02 | 109 | 211 |
There are 208 matching structural neighberhood comparisons for CATH ID 2.60.40.10.4.1.1.1.1 (SIMAX score < 5)
>pdb|3d9aL01 DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVET EDFGMYFCQQSNSWPYTFGGGTKLEIKR
Assigning to "2.60.40.10" based on similarity with "3hfmL01"
No in_process hits for Domain "3d9aL01" ready to be processed
Domain "3d9aL01" hits Domain "3d85A01" (83.3333333333333% over 100%) which is currently in process
Domain "3d9aL01" hits Domain "3cvhL01" (54.2056074766355% over 99.0740740740741%) which is currently in process
Domain "3d9aL01" hits Domain "3cvhR01" (54.2056074766355% over 99.0740740740741%) which is currently in process
Domain "3d9aL01" hits Domain "3cviL01" (54.2056074766355% over 99.0740740740741%) which is currently in process
Domain "3d9aL01" hits Domain "3csyB01" (55.5555555555556% over 94.6902654867257%) which is currently in process
Domain "3d9aL01" hits Domain "3csyF01" (55.5555555555556% over 94.6902654867257%) which is currently in process
Domain "3d9aL01" hits Domain "3csyD01" (55.5555555555556% over 94.6902654867257%) which is currently in process
Domain "3d9aL01" hits Domain "3csyH01" (55.5555555555556% over 94.6902654867257%) which is currently in process
Domain "3d9aL01" hits Domain "3cmoL01" (57.5471698113208% over 98.1481481481482%) which is currently in process
Domain "3d9aL01" hits Domain "3cmoX01" (57.5471698113208% over 98.1481481481482%) which is currently in process
Domain "3d9aL01" hits Domain "3cleL01" (58.8785046728972% over 99.0740740740741%) which is currently in process
Domain "3d9aL01" hits Domain "3clfL01" (58.8785046728972% over 99.0740740740741%) which is currently in process
Domain "3d9aL01" hits Domain "3cfkJ01" (43.5185185185185% over 97.2727272727273%) which is currently in process
Domain "3d9aL01" hits Domain "3cfjC01" (43.5185185185185% over 97.2727272727273%) which is currently in process
Domain "3d9aL01" hits Domain "3cfkG01" (43.5185185185185% over 97.2727272727273%) which is currently in process
Domain "3d9aL01" hits Domain "3cfjE01" (43.5185185185185% over 97.2727272727273%) which is currently in process
Domain "3d9aL01" hits Domain "3cfkL01" (43.5185185185185% over 97.2727272727273%) which is currently in process
Domain "3d9aL01" hits Domain "3cfkA01" (43.5185185185185% over 97.2727272727273%) which is currently in process
Domain "3d9aL01" hits Domain "3cfkO01" (43.5185185185185% over 97.2727272727273%) which is currently in process
Domain "3d9aL01" hits Domain "3cfkE01" (43.5185185185185% over 97.2727272727273%) which is currently in process
Domain "3d9aL01" hits Domain "3cfjL01" (43.5185185185185% over 97.2727272727273%) which is currently in process
Domain "3d9aL01" hits Domain "3cfkC01" (43.5185185185185% over 97.2727272727273%) which is currently in process
Domain "3d9aL01" hits Domain "3d0vA01" (51.4018691588785% over 99.0740740740741%) which is currently in process
Domain "3d9aL01" hits Domain "3d0lA01" (51.4018691588785% over 99.0740740740741%) which is currently in process
Domain "3d9aL01" hits Domain "3cfdL01" (57.0093457943925% over 99.0740740740741%) which is currently in process
Domain "3d9aL01" hits Domain "3cfeL01" (57.0093457943925% over 99.0740740740741%) which is currently in process
Domain "3d9aL01" hits Domain "3cfeA01" (57.0093457943925% over 99.0740740740741%) which is currently in process
Domain "3d9aL01" hits Domain "3cfdA01" (57.0093457943925% over 99.0740740740741%) which is currently in process
Domain "3d9aL01" hits Domain "3cfcL01" (57.4074074074074% over 95.5752212389381%) which is currently in process
Domain "3d9aL01" hits Domain "3cfbA01" (57.4074074074074% over 95.5752212389381%) which is currently in process
Domain "3d9aL01" hits Domain "3cfbL01" (57.4074074074074% over 95.5752212389381%) which is currently in process
Domain "3d9aL01" hits Domain "3c6sC01" (57.4074074074074% over 95.5752212389381%) which is currently in process
Domain "3d9aL01" hits Domain "3c6sA01" (57.4074074074074% over 95.5752212389381%) which is currently in process
Domain "3d9aL01" hits Domain "3c6sE01" (57.4074074074074% over 95.5752212389381%) which is currently in process
Domain "3d9aL01" hits Domain "3c6sG01" (57.4074074074074% over 95.5752212389381%) which is currently in process
Domain "3d9aL01" hits Domain "3c5sC01" (57.4074074074074% over 95.5752212389381%) which is currently in process
Domain "3d9aL01" hits Domain "3c5sA01" (57.4074074074074% over 95.5752212389381%) which is currently in process
Domain "3d9aL01" hits Domain "3c2aL01" (46.2962962962963% over 95.4954954954955%) which is currently in process
Domain "3d9aL01" hits Domain "3c2aM01" (46.2962962962963% over 95.4954954954955%) which is currently in process
Domain "3d9aL01" hits Domain "3c2aM01" (46.2962962962963% over 95.4954954954955%) which is currently in process
NW result present for Domain "3d9aL01"
All required files are present for Domain "3d9aL01"
Beginning processing for Domain "3d9aL01"
Final ChopClose added based on similarity with "3hfmL"