Domain assigned by cuff on 15 Apr 2009 11:21
superfamily match
CATH Domain: 3cwvA02
3cwvA02
PDB 3cwv, Chain A, Domain 2
| CATH Code | Level Description | Links |
|---|---|---|
 3
| Alpha Beta | |
 3.30
| 2-Layer Sandwich | |
 3.30.230
| Ribosomal Protein S5; domain 2 | |
 3.30.230.10
| Gene3D | |
 3.30.230.10.10
| ||
 3.30.230.10.10.1
| ||
 3.30.230.10.10.1.1
| ||
 3.30.230.10.10.1.1.1
| ||
 3.30.230.10.10.1.1.1.1
|
Segment boundaries for domain 3cwvA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3cwvA01 | 8 | 205 |
| 3cwvA02 | 206 | 356 |
Structural Neighbourhood (2 entries)
There are 2 matching structural neighberhood comparisons for CATH ID 3.30.230.10.10.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 2 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
|
1s16A02 | 86.13 | 3.30.230.10 | 168 | 21 | 88 | 2.99 | 3.37 | |
|
1ei1A02 | 85.53 | 3.30.230.10 | 173 | 24 | 86 | 2.95 | 3.43 |
[1]
Displaying entries 1 to 2 (page 1 of 1)
Domain ATOM Sequence
>pdb|3cwvA02 GGVAQWAHVLTEARPQLHPEPVVFDFTWDGLRVQCALQWCEDEDSTLLSFANAVRTVRHGAHVKGVTQALRGALAKLSGE TRGAFPWARVAQGLTAIVAVSGPRRQMAFAGPTKELLAIPGLEEAIRKQLQPLFIELLREHPVTPALLARR
Domain History Events (82)
Domain assignment manual match h by cuff on 15 Apr 2009 11:21
superfamily match
Homcheck allotment by cuff on 15 Apr 2009 11:20
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 15 Apr 2009 11:20
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 16 Mar 2009 06:59
Domain "3cwvA02" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 16 Mar 2009 06:58
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cwvA02
Flow stage update by auto on 16 Mar 2009 04:19
Retrieved PRC_PFAMCATH results for job ID SID4554364622482976 and results inserted.
Domain scan prc pfamcath by auto on 16 Mar 2009 04:17
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 3 results for 3cwvA02
Update comment by auto on 12 Mar 2009 14:59
PRC_PFAMCATH job SID4554364622482976 is not yet finished.
Flow stage update by auto on 12 Mar 2009 14:49
The entry "3cwvA02" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 12 Mar 2009 14:49
The entry "3cwvA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 12 Mar 2009 14:15
Retrieved SSAP results for job ID SID4227489662942064 and results inserted.
Domain scan ssap cath by auto on 12 Mar 2009 14:12
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 954 results for 3cwvA02
Update comment by auto on 09 Mar 2009 22:06
SSAP job SID4227489662942064 is not yet finished.
Ssap cath submit by auto on 09 Mar 2009 21:52
The entry "3cwvA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Mar 2009 21:52
The entry "3cwvA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Mar 2009 20:53
Retrieved PRC results for job ID SID7618039014578560 and inserted them into the database.
Domain scan prc cath by auto on 09 Mar 2009 20:53
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 4 results for 3cwvA02
Update comment by auto on 09 Mar 2009 12:44
PRC job SID7618039014578560 is not yet finished.
Prc cath submit by auto on 09 Mar 2009 12:20
The entry "3cwvA02" has been submitted to the PRC webservice.
Flow stage update by auto on 09 Mar 2009 12:20
The entry "3cwvA02" has been submitted to the PRC webservice.
Flow stage update by auto on 09 Mar 2009 11:18
Retrieved HMM(SAM) results for job ID SID9599750859581452 and inserted them into the database.
Domain scan sam cath by auto on 09 Mar 2009 11:18
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 3cwvA02
Update comment by auto on 04 Mar 2009 12:47
HMM(SAM) job SID9599750859581452 is not yet finished.
Sam cath submit by auto on 04 Mar 2009 12:20
The entry "3cwvA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Mar 2009 12:20
The entry "3cwvA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Mar 2009 05:55
Unable to retrieve "3cwvA02" HMM(SAM) results for job "SID1588396262018328"
Update comment by auto on 04 Mar 2009 01:28
HMM(SAM) job SID1588396262018328 is not yet finished.
Sam cath submit by auto on 04 Mar 2009 00:06
The entry "3cwvA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Mar 2009 00:06
The entry "3cwvA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 16:21
Unable to retrieve "3cwvA02" HMM(SAM) results for job "SID4800342253730016"
Flow stage update by auto on 19 Feb 2009 15:31
The entry "3cwvA02" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 19 Feb 2009 15:31
The entry "3cwvA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 14:17
Retrieved "3cwvA02" CATHEDRAL results for job ID SID8527239253369376 and inserted them into the database.
Domain scan cathedral cath by auto on 19 Feb 2009 14:16
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 73 results for 3cwvA02
Update comment by auto on 19 Feb 2009 07:48
"3cwvA02" CATHEDRAL job SID8527239253369376 is not yet finished.
Cathedral cath submit by auto on 19 Feb 2009 06:33
The entry "3cwvA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 19 Feb 2009 06:33
The entry "3cwvA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 27 Jan 2009 12:08
Unable to retrieve "3cwvA02" CATHEDRAL results for job "SID7240452327969456"
Update comment by auto on 22 Jan 2009 17:17
"3cwvA02" CATHEDRAL job SID7240452327969456 is not yet finished.
Cathedral cath submit by auto on 22 Jan 2009 16:55
The entry "3cwvA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Jan 2009 16:55
The entry "3cwvA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 21 Dec 2008 15:19
ScanList with 12830 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3cwvA02.scanlist" for "3cwvA02"
Write scan list by auto on 21 Dec 2008 15:19
Writing ScanList containing 12830 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3cwvA02.scanlist" for domain "3cwvA02"
Update comment by auto on 21 Dec 2008 11:52
Waiting for 76 new domains (example : 3davB00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 20:42
Waiting for 113 new domains (example : 3bmkB00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 19:04
Waiting for 148 new domains (example : 3bllA00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 14:36
Waiting for 197 new domains (example : 2vmtA02) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 11:36
Waiting for 239 new domains (example : 2jknF00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 07:50
Waiting for 256 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 03:59
Waiting for 248 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 00:50
Waiting for 246 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 19 Dec 2008 20:43
Waiting for 197 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 19 Dec 2008 16:56
Waiting for 189 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 19 Dec 2008 11:35
Waiting for 32 new domains (example : 2jknA00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 23:34
Waiting for 2 new domains (example : 3fcxA00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 22:12
Waiting for 27 new domains (example : 3ex7B00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 17:38
Waiting for 80 new domains (example : 2zecD01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 14:53
Waiting for 132 new domains (example : 2zebD01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 11:32
Waiting for 174 new domains (example : 2zebD01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 09:48
Waiting for 227 new domains (example : 2w42B01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 04:25
Waiting for 270 new domains (example : 2rklB00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 00:28
Waiting for 285 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 20:36
Waiting for 267 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 18:32
Waiting for 261 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 14:43
Waiting for 215 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 10:55
Waiting for 201 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Dec 2008 20:40
Waiting for 150 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Dec 2008 17:14
Waiting for 297 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Dec 2008 20:42
Waiting for 337 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Dec 2008 17:19
Waiting for 547 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 13 Dec 2008 20:38
Waiting for 598 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 13 Dec 2008 16:51
Waiting for 852 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 12 Dec 2008 20:56
Waiting for 902 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 12 Dec 2008 17:06
Waiting for 1430 new domains (example : 2nrfA00) to be processed so that they can be scanned against too.
Update comment by auto on 10 Dec 2008 14:48
Waiting for 1534 new domains (example : 2gqgA02) to be processed so that they can be scanned against too.
Flow stage update by auto on 10 Dec 2008 14:43
No satisfactory AssignClose result found.
Flow stage update by auto on 10 Dec 2008 14:17
No in_process hits for Domain "3cwvA02" ready to be processed
Flow stage update by auto on 10 Dec 2008 14:17
NW result present for Domain "3cwvA02"
Flow stage update by auto on 05 Dec 2008 08:14
All required files are present for Domain "3cwvA02"
Flow stage update by auto on 04 Dec 2008 17:23
Beginning processing for Domain "3cwvA02"
Insertion by cuff on 04 Dec 2008 15:46
nice chopping
