CATH Domain: 3cwvA01 XML data for domain: 3cwvA01

Molscript image for 3cwvA01
3cwvA01
PDB coordinates for domain 3cwvA01

PDB 3cwv, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.565 Heat Shock Protein 90
3.30.565.10 Gene3D
3.30.565.10.4
3.30.565.10.4.1
3.30.565.10.4.1.1
3.30.565.10.4.1.1.1
3.30.565.10.4.1.1.1.1

Segment boundaries for domain 3cwvA01

Chopping figure for domain 3cwvA01
DomainStart PDB ResidueStop PDB Residue
3cwvA01 8 205
3cwvA02 206 356

Domain ATOM Sequence

>pdb|3cwvA01
GGIVENVRKRPGMYCGDVGEYGLHHLVYFLLDVAYEEARRGECRDVVLEVGGDGSIALFCTSRTVTAENLVRVATGAGFL
GRPPGDGWGWDSMLVVSLALSSRYQVDIWADGRQWRVMGEHGHPQGEGAAVTPMEPMPVSAERGVRVHFVPDATIFEVLA
FDRARLSRRCNELAALAPGLRVSFADLQRGERTLWHLP    

Domain COMBS Sequence

>pdb|3cwvA01
MSLGMHLPGGIVENVRKRPGMYCGDVGEYGLHHLVYFLLDVAYEEARRGECRDVVLEVGGDGSIALFCTSRTVTAENLVR
VATGAGFLGRPPGDGWGWDSMLVVSLALSSRYQVDIWADGRQWRVMGEHGHPQGEGAAVTPMEPMPVSAERGVRVHFVPD
ATIFEVLAFDRARLSRRCNELAALAPGLRVSFADLQRGERTLWHLP    

Domain History Events (82)

Domain assigned by cuff on 15 Apr 2009 11:19

superfamily match

Domain assignment manual match h by cuff on 15 Apr 2009 11:19

homology match

Homcheck allotment by cuff on 15 Apr 2009 11:18

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 15 Apr 2009 11:18

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 16 Mar 2009 07:00

Domain "3cwvA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 16 Mar 2009 06:59

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cwvA01

Flow stage update by auto on 16 Mar 2009 04:20

Retrieved PRC_PFAMCATH results for job ID SID2046647026827864 and results inserted.

Domain scan prc pfamcath by auto on 16 Mar 2009 04:19

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 15 results for 3cwvA01

Update comment by auto on 12 Mar 2009 19:38

PRC_PFAMCATH job SID2046647026827864 is not yet finished.

Flow stage update by auto on 12 Mar 2009 19:29

The entry "3cwvA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 12 Mar 2009 19:29

The entry "3cwvA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 12 Mar 2009 18:27

Retrieved SSAP results for job ID SID3434419628305200 and results inserted.

Domain scan ssap cath by auto on 12 Mar 2009 18:25

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 494 results for 3cwvA01

Update comment by auto on 09 Mar 2009 22:06

SSAP job SID3434419628305200 is not yet finished.

Ssap cath submit by auto on 09 Mar 2009 21:51

The entry "3cwvA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Mar 2009 21:51

The entry "3cwvA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Mar 2009 20:53

Retrieved PRC results for job ID SID6721192188969764 and inserted them into the database.

Domain scan prc cath by auto on 09 Mar 2009 20:52

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 14 results for 3cwvA01

Update comment by auto on 09 Mar 2009 12:44

PRC job SID6721192188969764 is not yet finished.

Prc cath submit by auto on 09 Mar 2009 12:20

The entry "3cwvA01" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Mar 2009 12:20

The entry "3cwvA01" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Mar 2009 11:18

Retrieved HMM(SAM) results for job ID SID5299569257056162 and inserted them into the database.

Domain scan sam cath by auto on 09 Mar 2009 11:17

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 3cwvA01

Update comment by auto on 04 Mar 2009 12:47

HMM(SAM) job SID5299569257056162 is not yet finished.

Sam cath submit by auto on 04 Mar 2009 12:20

The entry "3cwvA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 12:20

The entry "3cwvA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 05:55

Unable to retrieve "3cwvA01" HMM(SAM) results for job "SID0032319982945978"

Update comment by auto on 04 Mar 2009 01:28

HMM(SAM) job SID0032319982945978 is not yet finished.

Flow stage update by auto on 04 Mar 2009 00:05

The entry "3cwvA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Mar 2009 00:05

The entry "3cwvA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:21

Unable to retrieve "3cwvA01" HMM(SAM) results for job "SID3926604739762400"

Sam cath submit by auto on 19 Feb 2009 15:31

The entry "3cwvA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 15:31

The entry "3cwvA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 14:16

Retrieved "3cwvA01" CATHEDRAL results for job ID SID7468301743575168 and inserted them into the database.

Domain scan cathedral cath by auto on 19 Feb 2009 14:16

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 77 results for 3cwvA01

Update comment by auto on 19 Feb 2009 07:48

"3cwvA01" CATHEDRAL job SID7468301743575168 is not yet finished.

Flow stage update by auto on 19 Feb 2009 06:33

The entry "3cwvA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 19 Feb 2009 06:33

The entry "3cwvA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 27 Jan 2009 12:08

Unable to retrieve "3cwvA01" CATHEDRAL results for job "SID5405139348663888"

Update comment by auto on 22 Jan 2009 17:17

"3cwvA01" CATHEDRAL job SID5405139348663888 is not yet finished.

Flow stage update by auto on 22 Jan 2009 16:55

The entry "3cwvA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 22 Jan 2009 16:55

The entry "3cwvA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 21 Dec 2008 15:19

ScanList with 12830 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3cwvA01.scanlist" for "3cwvA01"

Write scan list by auto on 21 Dec 2008 15:19

Writing ScanList containing 12830 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3cwvA01.scanlist" for domain "3cwvA01"

Update comment by auto on 21 Dec 2008 11:52

Waiting for 76 new domains (example : 3davB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 20:42

Waiting for 113 new domains (example : 3bmkB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 19:04

Waiting for 148 new domains (example : 3bllA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 14:36

Waiting for 197 new domains (example : 2vmtA02) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 11:36

Waiting for 239 new domains (example : 2jknF00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 07:50

Waiting for 256 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 03:59

Waiting for 248 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 00:50

Waiting for 246 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 20:43

Waiting for 197 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 16:56

Waiting for 189 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 11:35

Waiting for 32 new domains (example : 2jknA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 23:34

Waiting for 2 new domains (example : 3fcxA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 22:12

Waiting for 27 new domains (example : 3ex7B00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 17:38

Waiting for 80 new domains (example : 2zecD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 14:53

Waiting for 132 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 11:32

Waiting for 174 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 09:48

Waiting for 227 new domains (example : 2w42B01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 04:25

Waiting for 270 new domains (example : 2rklB00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 00:28

Waiting for 285 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 20:36

Waiting for 267 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 18:32

Waiting for 261 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 14:43

Waiting for 215 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 10:55

Waiting for 201 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Dec 2008 20:40

Waiting for 150 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Dec 2008 17:14

Waiting for 297 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Dec 2008 20:42

Waiting for 337 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Dec 2008 17:19

Waiting for 547 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Dec 2008 20:38

Waiting for 598 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Dec 2008 16:51

Waiting for 852 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Dec 2008 20:56

Waiting for 902 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Dec 2008 17:06

Waiting for 1430 new domains (example : 2nrfA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Dec 2008 14:48

Waiting for 1534 new domains (example : 2gqgA02) to be processed so that they can be scanned against too.

Flow stage update by auto on 10 Dec 2008 14:43

No satisfactory AssignClose result found.

Flow stage update by auto on 10 Dec 2008 14:17

No in_process hits for Domain "3cwvA01" ready to be processed

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "3cwvA01"

Flow stage update by auto on 05 Dec 2008 08:14

All required files are present for Domain "3cwvA01"

Flow stage update by auto on 04 Dec 2008 17:23

Beginning processing for Domain "3cwvA01"

Insertion by cuff on 04 Dec 2008 15:46

nice chopping