CATH Domain: 3cwiA00 XML data for domain: 3cwiA00

Molscript image for 3cwiA00
3cwiA00
PDB coordinates for domain 3cwiA00

PDB 3cwi, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.20 Ubiquitin-like (UB roll)
3.10.20.30 Gene3D
3.10.20.30.18
3.10.20.30.18.1
3.10.20.30.18.1.1
3.10.20.30.18.1.1.1
3.10.20.30.18.1.1.1.1

[top]
Segment boundaries for domain 3cwiA00

Chopping figure for domain 3cwiA00
DomainStart PDB ResidueStop PDB Residue
3cwiA00 2 69

Structural Neighbourhood (21 entries)

There are 21 matching structural neighberhood comparisons for CATH ID 3.10.20.30.18.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 21 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1zud400 91.51 Sulfur carrier protein ThiSThiamine biosynthesis ThiSEscherichia coli K-12 3.10.20.30 66 22 95 1.52 1.59
1tygB00 89.91 Sulfur carrier protein ThiSThiamine biosynthesis ThiSBacillus subtilis 3.10.20.30 65 27 97 2.18 2.25
1ryjA00 84.99 Methanothermobacter thermautotrophicus str. Delta HPutative uncharacterized protein 3.10.20.30 70 23 85 2.41 2.81
2kd0A01 82.25 LRR repeats and ubiquitin-like domain-containing protein At2g30105Arabidopsis thaliana 3.10.20.90 71 20 85 3.19 3.71
1yqbA01 82.05 Ubiquilin-3Homo sapiensUbiquilin 3.10.20.90 71 16 85 3.26 3.79
2bwfA00 80.19 Ubiquitin domain-containing protein DSK2Protein binding, bridgingSpindle pole body duplication in nuclear envelopeSaccharomyces cerevisiaeER-associated protein catabolic process 3.10.20.90 77 14 83 3.91 4.70
2zeqA00 80.11 Synaptic transmission, glutamatergicLearningAdult locomotory behaviorParkinson's diseaseDopamine metabolic process 3.10.20.90 78 17 80 3.83 4.74
1m94A00 79.94 Ubiquitin-like protein 5Protein modification processProtein bindingNuclear mRNA splicing, via spliceosomeMating projection 3.10.20.90 73 17 87 4.05 4.62
1z2mA01 79.83 RIG-I-like receptor signaling pathwayInterferon-induced 17 kDa proteinISG15-protein conjugationHomo sapiensUbiquitin cross-reactive protein 3.10.20.90 75 13 82 3.29 3.98
2fazA00 79.64 E3 ubiquitin-protein ligase UHRF1RNA polymerase II transcription factor activityProtein bindingCell proliferationSequence-specific DNA binding transcription factor activity 3.10.20.90 77 11 84 3.78 4.48
2gbjB00 79.27 3.10.20.90 84 10 77 3.80 4.91
1t0yA00 77.38 Caenorhabditis elegansTubulin-specific chaperone B 3.10.20.90 90 14 70 3.13 4.47
1z2mA02 77.30 RIG-I-like receptor signaling pathwayInterferon-induced 17 kDa proteinISG15-protein conjugationHomo sapiensUbiquitin cross-reactive protein 3.10.20.90 77 14 81 4.07 4.97
1rwsA00 77.11 Pyrococcus furiosusPutative uncharacterized protein 3.10.20.30 68 16 85 3.72 4.36
1wh3A01 76.68 CytoplasmDNA binding59 kDa 2'-5'-oligoadenylate synthase-like proteinThyroid hormone receptor bindingNucleolus 3.10.20.90 71 11 88 4.29 4.83
1c1yB00 76.44 RAF proto-oncogene serine/threonine-protein kinaseNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathwayProtein binding 3.10.20.90 77 11 76 3.63 4.74
2c60A01 75.79 Neurotrophin signaling pathwayMitogen-activated protein kinase kinase kinase 3MAPKKK cascadeProtein bindingPositive regulation of I-kappaB kinase/NF-kappaB cascade 3.10.20.240 77 7 79 3.64 4.59
1h4rA01 75.46 Negative regulation of cell-cell adhesionSchwann cell proliferationCytoskeletonNucleolusEarly endosome 3.10.20.90 78 5 78 3.90 4.99
1h8cA00 74.51 Cytoplasmic sequestering of NF-kappaBHeat shock protein bindingFAS-associated factor 1CytosolPositive regulation of protein complex assembly 3.10.20.90 82 5 75 3.72 4.92
1wmhB00 72.67 Partitioning defective 6 homolog alphaTranscription factor bindingViral reproductionHomo sapiens 3.10.20.240 82 7 78 3.87 4.96
1wmhA00 72.55 Tight junctionInsulin signaling pathwayEndocytosisVesicle-mediated transportProtein binding 3.10.20.240 83 5 75 3.63 4.78
[1]
Displaying entries 1 to 21 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3cwiA00
NLTVNGKPSTVDGAESLNVTELLSALKVAQAEYVTVELNGEVLEREAFDATTVKDGDAVEFLYFGGG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3cwiA00
XNLTVNGKPSTVDGAESLNVTELLSALKVAQAEYVTVELNGEVLEREAFDATTVKDGDAVEFLYFXGGGKLEHHHHHH
BLAST against CATH

[top]
Domain History Events (82)

Domain assigned by cuff on 12 Mar 2009 12:34

homology match

Domain assignment manual match h by cuff on 12 Mar 2009 12:31

same superfamily

Homcheck allotment by cuff on 12 Mar 2009 12:26

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 12 Mar 2009 12:26

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 12 Mar 2009 05:30

Domain "3cwiA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 12 Mar 2009 05:30

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cwiA00

Flow stage update by auto on 12 Mar 2009 05:28

Retrieved PRC_PFAMCATH results for job ID SID0561728750568088 and results inserted.

Domain scan prc pfamcath by auto on 12 Mar 2009 05:27

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 8 results for 3cwiA00

Update comment by auto on 11 Mar 2009 22:56

PRC_PFAMCATH job SID0561728750568088 is not yet finished.

Flow stage update by auto on 11 Mar 2009 22:50

The entry "3cwiA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 11 Mar 2009 22:50

The entry "3cwiA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 11 Mar 2009 22:42

Retrieved SSAP results for job ID SID6003023878561952 and results inserted.

Domain scan ssap cath by auto on 11 Mar 2009 22:38

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2124 results for 3cwiA00

Update comment by auto on 09 Mar 2009 22:06

SSAP job SID6003023878561952 is not yet finished.

Flow stage update by auto on 09 Mar 2009 21:51

The entry "3cwiA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 09 Mar 2009 21:51

The entry "3cwiA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Mar 2009 20:50

Retrieved PRC results for job ID SID2204908289304720 and inserted them into the database.

Domain scan prc cath by auto on 09 Mar 2009 20:50

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 6 results for 3cwiA00

Update comment by auto on 09 Mar 2009 12:44

PRC job SID2204908289304720 is not yet finished.

Prc cath submit by auto on 09 Mar 2009 12:19

The entry "3cwiA00" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Mar 2009 12:19

The entry "3cwiA00" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Mar 2009 11:15

Retrieved HMM(SAM) results for job ID SID5896817873503319 and inserted them into the database.

Domain scan sam cath by auto on 09 Mar 2009 11:14

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 3cwiA00

Update comment by auto on 04 Mar 2009 12:47

HMM(SAM) job SID5896817873503319 is not yet finished.

Sam cath submit by auto on 04 Mar 2009 12:20

The entry "3cwiA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 12:20

The entry "3cwiA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 05:54

Unable to retrieve "3cwiA00" HMM(SAM) results for job "SID0877414892303932"

Update comment by auto on 04 Mar 2009 01:28

HMM(SAM) job SID0877414892303932 is not yet finished.

Sam cath submit by auto on 04 Mar 2009 00:05

The entry "3cwiA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 00:05

The entry "3cwiA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:20

Unable to retrieve "3cwiA00" HMM(SAM) results for job "SID3241193131425574"

Sam cath submit by auto on 19 Feb 2009 15:31

The entry "3cwiA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 15:31

The entry "3cwiA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 14:13

Retrieved "3cwiA00" CATHEDRAL results for job ID SID0323113069090144 and inserted them into the database.

Domain scan cathedral cath by auto on 19 Feb 2009 14:12

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 72 results for 3cwiA00

Update comment by auto on 19 Feb 2009 07:47

"3cwiA00" CATHEDRAL job SID0323113069090144 is not yet finished.

Cathedral cath submit by auto on 19 Feb 2009 06:33

The entry "3cwiA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 19 Feb 2009 06:33

The entry "3cwiA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 27 Jan 2009 12:08

Unable to retrieve "3cwiA00" CATHEDRAL results for job "SID5386712951744792"

Update comment by auto on 22 Jan 2009 17:17

"3cwiA00" CATHEDRAL job SID5386712951744792 is not yet finished.

Cathedral cath submit by auto on 22 Jan 2009 16:54

The entry "3cwiA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Jan 2009 16:54

The entry "3cwiA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 21 Dec 2008 15:18

ScanList with 12830 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3cwiA00.scanlist" for "3cwiA00"

Write scan list by auto on 21 Dec 2008 15:18

Writing ScanList containing 12830 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3cwiA00.scanlist" for domain "3cwiA00"

Update comment by auto on 21 Dec 2008 11:52

Waiting for 76 new domains (example : 3davB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 20:42

Waiting for 113 new domains (example : 3bmkB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 19:04

Waiting for 148 new domains (example : 3bllA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 14:36

Waiting for 197 new domains (example : 2vmtA02) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 11:36

Waiting for 239 new domains (example : 2jknF00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 07:50

Waiting for 256 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 03:59

Waiting for 248 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 00:50

Waiting for 246 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 20:43

Waiting for 197 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 16:56

Waiting for 189 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 11:35

Waiting for 32 new domains (example : 2jknA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 23:34

Waiting for 2 new domains (example : 3fcxA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 22:12

Waiting for 27 new domains (example : 3ex7B00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 17:38

Waiting for 80 new domains (example : 2zecD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 14:53

Waiting for 132 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 11:32

Waiting for 174 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 09:48

Waiting for 227 new domains (example : 2w42B01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 04:25

Waiting for 270 new domains (example : 2rklB00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 00:28

Waiting for 285 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 20:36

Waiting for 267 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 18:32

Waiting for 261 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 14:43

Waiting for 215 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 10:55

Waiting for 201 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Dec 2008 20:40

Waiting for 150 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Dec 2008 17:14

Waiting for 297 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Dec 2008 20:42

Waiting for 337 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Dec 2008 17:19

Waiting for 547 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Dec 2008 20:38

Waiting for 598 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Dec 2008 16:51

Waiting for 852 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Dec 2008 20:56

Waiting for 902 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Dec 2008 17:06

Waiting for 1430 new domains (example : 2nrfA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Dec 2008 14:48

Waiting for 1534 new domains (example : 2gqgA02) to be processed so that they can be scanned against too.

Flow stage update by auto on 10 Dec 2008 14:43

No satisfactory AssignClose result found.

Flow stage update by auto on 10 Dec 2008 14:17

No in_process hits for Domain "3cwiA00" ready to be processed

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "3cwiA00"

Flow stage update by auto on 05 Dec 2008 08:14

All required files are present for Domain "3cwiA00"

Flow stage update by auto on 04 Dec 2008 17:23

Beginning processing for Domain "3cwiA00"

Insertion by cuff on 04 Dec 2008 15:46

nice chopping