Domain assigned by auto on 03 Apr 2009 17:42
Assigning to "3.40.50.10490" based on similarity with "3cvjA00"
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|3cvjC00 TSSFTDYCKFFNRILSEVQETQEQAIIKGAHLVSEAVNGGRFYVFGSGHSHIAEEIYNRAGGLALVTAILPPELLHERPN KSTYLERIEGLSKSYLKLHQVTNKDVIIISNSGRNTVPVEAIESRNIGAKVIATSKHSQKVTSRHKSGKKLYEYADVVLD NGAPVGDAGFQIANSEIYSGATSDSIGCFLAQALIVETLHLLVQQGFEPPVFKSSNVDGADLYNDKIFNEYVKW
Assigning to "3.40.50.10490" based on similarity with "3cvjA00"
No in_process hits for Domain "3cvjC00" ready to be processed
Domain "3cvjC00" hits Domain "3cvjA00" (96.7078189300412% over 100%) which is currently in process
Domain "3cvjC00" hits Domain "3cvjB00" (96.7078189300412% over 100%) which is currently in process
Domain "3cvjC00" hits Domain "3cvjB00" (96.7078189300412% over 100%) which is currently in process
NW result present for Domain "3cvjC00"
All required files are present for Domain "3cvjC00"
Beginning processing for Domain "3cvjC00"
nice chopping