CATH Domain: 3ctkA01 XML data for domain: 3ctkA01

Molscript image for 3ctkA01
3ctkA01
PDB coordinates for domain 3ctkA01

PDB 3ctk, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.420 Ricin (A subunit); domain 1
3.40.420.10 Ricin (A subunit), domain 1 Gene3D
3.40.420.10.5
3.40.420.10.5.2
3.40.420.10.5.2.1
3.40.420.10.5.2.1.1
3.40.420.10.5.2.1.1.1

[top]
Segment boundaries for domain 3ctkA01

Chopping figure for domain 3ctkA01
DomainStart PDB ResidueStop PDB Residue
3ctkA01 1 167
3ctkA02 168 248

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.420.10.5.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1abrA01 91.02 RRNA N-glycosylase activityAbrus precatoriusAbrin-aGalactose bindingNegative regulation of translation 3.40.420.10 166 37 97 1.63 1.67
1r4pA01 87.20 Pathogenic Escherichia coli infectionShiga toxin subunit AShiga-like toxin 2 subunit AEnterobacteria phage 933W 3.40.420.10 170 16 91 2.26 2.48
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3ctkA01
YNTVSFNLGEAYEYPTFIQDLRNELAKGTPVCQLPVTLQTIADDKRFVLVDITTTSKKTVKVAIDVTDVYVVGYQDKWDG
KDRAVFLDKVPTVATSKLFPGVTNRVTLTFDGSYQKLVNAAKVDRKDLELGVYKLEFSIEAIHGKTINGQEIAKFFLIVI
QMVSEAA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3ctkA01
YNTVSFNLGEAYEYPTFIQDLRNELAKGTPVCQLPVTLQTIADDKRFVLVDITTTSKKTVKVAIDVTDVYVVGYQDKWDG
KDRAVFLDKVPTVATSKLFPGVTNRVTLTFDGSYQKLVNAAKVDRKDLELGVYKLEFSIEAIHGKTINGQEIAKFFLIVI
QMVSEAA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 31 Jul 2008 03:50

Assigning to "3.40.420.10" based on similarity with "1wucA01"

Flow stage update by auto on 31 Jul 2008 03:10

No in_process hits for Domain "3ctkA01" ready to be processed

Flow stage update by auto on 31 Jul 2008 03:10

NW result present for Domain "3ctkA01"

Flow stage update by auto on 26 Jul 2008 11:50

All required files are present for Domain "3ctkA01"

Flow stage update by auto on 26 Jul 2008 11:49

Beginning processing for Domain "3ctkA01"

Insertion by auto on 25 Jul 2008 23:27

Final ChopClose added based on similarity with "1wucA"