CATH Domain: 3crdA00 XML data for domain: 3crdA00

Molscript image for 3crdA00
3crdA00
PDB coordinates for domain 3crdA00

PDB 3crd, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.533 Death Domain, Fas
1.10.533.10 Death Domain, Fas Gene3D
1.10.533.10.7
1.10.533.10.7.1
1.10.533.10.7.1.1
1.10.533.10.7.1.1.1
1.10.533.10.7.1.1.1.1

[top]
Segment boundaries for domain 3crdA00

Chopping figure for domain 3crdA00
DomainStart PDB ResidueStop PDB Residue
3crdA00 1 100

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.533.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1dgnA00 79.19 Caspase recruitment domain-containing protein 18NOD-like receptor signaling pathwayCaspase recruitment domain-containing protein 18Homo sapiens 1.10.533.10 89 20 84 3.03 3.61
1a1wA00 73.45 FAS (TNFRSF6)-associated via death domainIdentical protein bindingPathways in cancerChagas diseaseAlzheimer's disease 1.10.533.10 83 10 77 3.51 4.56
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3crdA00
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFP
WVREKLKKAREEAMTDLPAG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3crdA00
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFP
WVREKLKKAREEAMTDLPAG
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "3crd000" to "3crdA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:13

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:13

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:34

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"