Domain assigned by cuff on 12 Mar 2009 10:31
homology match
CATH Domain: 3cpnA00
3cpnA00
PDB 3cpn, Chain A, Domain 0
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|3cpnA00 KILNPIIIQRADPIYKHNDGYYYFTASVPEYDRIEVRKAKTIEGLRNAEPVDVWRRHESGESNLIWAPEIHFINGAWYIY FAAAPDKNIEDDTFNHRFVIQNENENPFTGNWVEKGRIKTAWESFSLDATIFEHNEKLYYVWAQQDINIKGHSNIYIAEE NPWTLKTKPVLTKPELEWEIKGFWVNEGPAVLKKNGKIFITYSASATDVNYCIGLTAEENSNLLDKNSWTKSQTPVFKTS ENHQYGPGHNSFTVSEDGKHDVIVYHARNYTEIKGDPLYDPNRHTRAQIINWREDGTPDFGVPEVDSIETPV
Domain COMBS Sequence
>pdb|3cpnA00 SNAXENEKILNPIIIQRADPXIYKHNDGYYYFTASVPEYDRIEVRKAKTIEGLRNAEPVDVWRRHESGEXSNLIWAPEIH FINGAWYIYFAAAPDKNIEDDTFNHRXFVIQNENENPFTGNWVEKGRIKTAWESFSLDATIFEHNEKLYYVWAQQDINIK GHSNIYIAEXENPWTLKTKPVXLTKPELEWEIKGFWVNEGPAVLKKNGKIFITYSASATDVNYCIGXLTAEENSNLLDKN SWTKSQTPVFKTSXENHQYGPGHNSFTVSEDGKHDVIVYHARNYTEIKGDPLYDPNRHTRAQIINWREDGTPDFGVPEVD SLEIETPVKA
Domain History Events (82)
Domain assignment manual match h by cuff on 12 Mar 2009 10:29
homology match
Homcheck allotment by cuff on 12 Mar 2009 10:28
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 12 Mar 2009 10:28
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 12 Mar 2009 10:25
Domain "3cpnA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 12 Mar 2009 10:24
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cpnA00
Flow stage update by auto on 12 Mar 2009 10:16
Retrieved PRC_PFAMCATH results for job ID SID0013526785660992 and results inserted.
Domain scan prc pfamcath by auto on 12 Mar 2009 10:15
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 21 results for 3cpnA00
Update comment by auto on 12 Mar 2009 05:23
PRC_PFAMCATH job SID0013526785660992 is not yet finished.
Flow stage update by auto on 12 Mar 2009 05:17
The entry "3cpnA00" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 12 Mar 2009 05:16
The entry "3cpnA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 12 Mar 2009 04:02
Retrieved SSAP results for job ID SID6615969497687456 and results inserted.
Domain scan ssap cath by auto on 12 Mar 2009 04:01
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 71 results for 3cpnA00
Update comment by auto on 09 Mar 2009 22:04
SSAP job SID6615969497687456 is not yet finished.
Ssap cath submit by auto on 09 Mar 2009 21:48
The entry "3cpnA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Mar 2009 21:48
The entry "3cpnA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Mar 2009 20:31
Retrieved PRC results for job ID SID1550485215413072 and inserted them into the database.
Domain scan prc cath by auto on 09 Mar 2009 20:30
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 7 results for 3cpnA00
Update comment by auto on 09 Mar 2009 12:41
PRC job SID1550485215413072 is not yet finished.
Flow stage update by auto on 09 Mar 2009 12:13
The entry "3cpnA00" has been submitted to the PRC webservice.
Prc cath submit by auto on 09 Mar 2009 12:13
The entry "3cpnA00" has been submitted to the PRC webservice.
Flow stage update by auto on 09 Mar 2009 10:57
Retrieved HMM(SAM) results for job ID SID0489428622924625 and inserted them into the database.
Domain scan sam cath by auto on 09 Mar 2009 10:57
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 3cpnA00
Update comment by auto on 04 Mar 2009 12:45
HMM(SAM) job SID0489428622924625 is not yet finished.
Sam cath submit by auto on 04 Mar 2009 12:16
The entry "3cpnA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Mar 2009 12:16
The entry "3cpnA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Mar 2009 05:51
Unable to retrieve "3cpnA00" HMM(SAM) results for job "SID1187967895484418"
Update comment by auto on 04 Mar 2009 01:25
HMM(SAM) job SID1187967895484418 is not yet finished.
Sam cath submit by auto on 04 Mar 2009 00:01
The entry "3cpnA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Mar 2009 00:01
The entry "3cpnA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 16:17
Unable to retrieve "3cpnA00" HMM(SAM) results for job "SID3152835409894784"
Flow stage update by auto on 19 Feb 2009 15:27
The entry "3cpnA00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 19 Feb 2009 15:27
The entry "3cpnA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 13:49
Retrieved "3cpnA00" CATHEDRAL results for job ID SID7272348062212432 and inserted them into the database.
Domain scan cathedral cath by auto on 19 Feb 2009 13:48
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 65 results for 3cpnA00
Update comment by auto on 19 Feb 2009 07:45
"3cpnA00" CATHEDRAL job SID7272348062212432 is not yet finished.
Cathedral cath submit by auto on 19 Feb 2009 06:30
The entry "3cpnA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 19 Feb 2009 06:30
The entry "3cpnA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 27 Jan 2009 12:06
Unable to retrieve "3cpnA00" CATHEDRAL results for job "SID6034349720411459"
Update comment by auto on 22 Jan 2009 17:14
"3cpnA00" CATHEDRAL job SID6034349720411459 is not yet finished.
Flow stage update by auto on 22 Jan 2009 16:51
The entry "3cpnA00" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 22 Jan 2009 16:51
The entry "3cpnA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 21 Dec 2008 15:12
ScanList with 12830 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3cpnA00.scanlist" for "3cpnA00"
Write scan list by auto on 21 Dec 2008 15:12
Writing ScanList containing 12830 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3cpnA00.scanlist" for domain "3cpnA00"
Update comment by auto on 21 Dec 2008 11:52
Waiting for 76 new domains (example : 3davB00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 20:42
Waiting for 113 new domains (example : 3bmkB00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 19:04
Waiting for 148 new domains (example : 3bllA00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 14:36
Waiting for 197 new domains (example : 2vmtA02) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 11:36
Waiting for 239 new domains (example : 2jknF00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 07:50
Waiting for 256 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 03:59
Waiting for 248 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 00:50
Waiting for 246 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 19 Dec 2008 20:43
Waiting for 197 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 19 Dec 2008 16:56
Waiting for 189 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 19 Dec 2008 11:35
Waiting for 32 new domains (example : 2jknA00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 23:34
Waiting for 2 new domains (example : 3fcxA00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 22:12
Waiting for 27 new domains (example : 3ex7B00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 17:38
Waiting for 80 new domains (example : 2zecD01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 14:52
Waiting for 132 new domains (example : 2zebD01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 11:32
Waiting for 174 new domains (example : 2zebD01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 09:48
Waiting for 227 new domains (example : 2w42B01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 04:25
Waiting for 270 new domains (example : 2rklB00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 00:28
Waiting for 285 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 20:36
Waiting for 267 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 18:32
Waiting for 261 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 14:43
Waiting for 215 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 10:55
Waiting for 201 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Dec 2008 20:40
Waiting for 150 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Dec 2008 17:14
Waiting for 297 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Dec 2008 20:42
Waiting for 337 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Dec 2008 17:19
Waiting for 547 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 13 Dec 2008 20:38
Waiting for 598 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 13 Dec 2008 16:50
Waiting for 852 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 12 Dec 2008 20:56
Waiting for 902 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 12 Dec 2008 17:05
Waiting for 1430 new domains (example : 2nrfA00) to be processed so that they can be scanned against too.
Update comment by auto on 10 Dec 2008 14:48
Waiting for 1534 new domains (example : 2gqgA02) to be processed so that they can be scanned against too.
Flow stage update by auto on 10 Dec 2008 14:41
No satisfactory AssignClose result found.
Flow stage update by auto on 10 Dec 2008 14:17
No in_process hits for Domain "3cpnA00" ready to be processed
Flow stage update by auto on 10 Dec 2008 14:17
NW result present for Domain "3cpnA00"
Flow stage update by auto on 05 Dec 2008 08:14
All required files are present for Domain "3cpnA00"
Flow stage update by auto on 04 Dec 2008 17:23
Beginning processing for Domain "3cpnA00"
Insertion by cuff on 04 Dec 2008 11:51
nice chopping
