CATH Domain: 3co8A02 XML data for domain: 3co8A02

Molscript image for 3co8A02
3co8A02
PDB coordinates for domain 3co8A02

PDB 3co8, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.20 TIM Barrel
3.20.20.10 Alanine racemase Gene3D
3.20.20.10.4
3.20.20.10.4.1
3.20.20.10.4.1.1
3.20.20.10.4.1.1.1
3.20.20.10.4.1.1.1.1

[top]
Segment boundaries for domain 3co8A02

Chopping figure for domain 3co8A02
DomainStart PDB ResidueStop PDB Residue
3co8A01 2 14
3co8A01 236 370
3co8A02 15 235

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.20.20.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1xfcB02 86.96 Alanine racemaseMycobacterium tuberculosis 3.20.20.10 216 23 90 1.88 2.08
1w8gA00 79.72 UPF0001 protein yggSEscherichia coli K-12 3.20.20.10 226 13 84 2.85 3.37
1ct5A00 79.06 UPF0001 protein YBL036CIdentical protein bindingPyridoxal phosphate bindingSaccharomyces cerevisiae 3.20.20.10 225 13 85 3.04 3.54
2p3eA02 78.56 Diaminopimelate decarboxylase [EC:4.1.1.20]Diaminopimelate decarboxylaseMetabolic pathwaysLysine biosynthesisAquifex aeolicus 3.20.20.10 223 16 84 3.51 4.16
2nvaC02 78.53 Paramecium bursaria Chlorella virus 1A207R protein 3.20.20.10 229 14 82 3.28 4.00
2o0tA02 77.96 Lysine biosynthesisMetabolic pathwaysDiaminopimelate decarboxylase [EC:4.1.1.20]Diaminopimelate decarboxylaseMycobacterium tuberculosis 3.20.20.10 260 15 73 2.80 3.81
1knwA02 77.39 Lysine biosynthesisMetabolic pathwaysDiaminopimelate decarboxylase [EC:4.1.1.20]Diaminopimelate decarboxylaseProtein binding 3.20.20.10 244 15 77 3.08 3.96
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3co8A02
KSSLAYNVQYTKQVSGAKTLWLAVKSNAYGHGLLQVSKIARECGVDGLAVSVLDEGIAIRQAGIDDFILILGPIDVKYAP
IASKYHFLTTVSSLDWLKSADKILGKEKLSVNLAVDTGNRIGVRSKKDLKDEIEFLQEHSDHFSYDGIFTHFAFQRQKNR
WYELIDGLIPRYVHVNSGAAYHSKELPGCNSIARVGTVVYGVEPSEGV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3co8A02
KSSLAYNVQYTKQVSGAKTLWLAVKSNAYGHGLLQVSKIARECGVDGLAVSVLDEGIAIRQAGIDDFILILGPIDVKYAP
IASKYHFLTTVSSLDWLKSADKILGKEKLSVNLAVDTGXNRIGVRSKKDLKDEIEFLQEHSDHFSYDGIFTHFASSDNPD
DHYFQRQKNRWYELIDGLIXPRYVHVXNSGAAXYHSKELPGCNSIARVGTVVYGVEPSEGV
BLAST against CATH

[top]
Domain History Events (82)

Domain assigned by cuff on 01 Apr 2009 17:29

homology match

Domain assignment manual match h by cuff on 01 Apr 2009 17:28

same superfamily

Homcheck allotment by cuff on 01 Apr 2009 17:26

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 01 Apr 2009 17:26

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Mar 2009 20:21

Domain "3co8A02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Mar 2009 20:21

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3co8A02

Flow stage update by auto on 15 Mar 2009 19:26

Retrieved PRC_PFAMCATH results for job ID SID9801668202223168 and results inserted.

Domain scan prc pfamcath by auto on 15 Mar 2009 19:26

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 11 results for 3co8A02

Update comment by auto on 11 Mar 2009 18:04

PRC_PFAMCATH job SID9801668202223168 is not yet finished.

Prc pfamcath submit by auto on 11 Mar 2009 18:00

The entry "3co8A02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 11 Mar 2009 18:00

The entry "3co8A02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 11 Mar 2009 17:44

Retrieved SSAP results for job ID SID8228265030852864 and results inserted.

Domain scan ssap cath by auto on 11 Mar 2009 17:42

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1018 results for 3co8A02

Update comment by auto on 09 Mar 2009 22:03

SSAP job SID8228265030852864 is not yet finished.

Ssap cath submit by auto on 09 Mar 2009 21:48

The entry "3co8A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Mar 2009 21:48

The entry "3co8A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Mar 2009 20:28

Retrieved PRC results for job ID SID2337679479403467 and inserted them into the database.

Domain scan prc cath by auto on 09 Mar 2009 20:28

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 8 results for 3co8A02

Update comment by auto on 09 Mar 2009 12:40

PRC job SID2337679479403467 is not yet finished.

Prc cath submit by auto on 09 Mar 2009 12:12

The entry "3co8A02" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Mar 2009 12:12

The entry "3co8A02" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Mar 2009 10:54

Retrieved HMM(SAM) results for job ID SID3423332877220525 and inserted them into the database.

Domain scan sam cath by auto on 09 Mar 2009 10:54

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 5 results for 3co8A02

Update comment by auto on 04 Mar 2009 12:44

HMM(SAM) job SID3423332877220525 is not yet finished.

Sam cath submit by auto on 04 Mar 2009 12:16

The entry "3co8A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 12:16

The entry "3co8A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 05:51

Unable to retrieve "3co8A02" HMM(SAM) results for job "SID0988171208541418"

Update comment by auto on 04 Mar 2009 01:25

HMM(SAM) job SID0988171208541418 is not yet finished.

Sam cath submit by auto on 04 Mar 2009 00:01

The entry "3co8A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 00:01

The entry "3co8A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:16

Unable to retrieve "3co8A02" HMM(SAM) results for job "SID6088102572847136"

Flow stage update by auto on 19 Feb 2009 15:27

The entry "3co8A02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 19 Feb 2009 15:27

The entry "3co8A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 13:46

Retrieved "3co8A02" CATHEDRAL results for job ID SID2947392562964560 and inserted them into the database.

Domain scan cathedral cath by auto on 19 Feb 2009 13:45

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 143 results for 3co8A02

Update comment by auto on 19 Feb 2009 07:45

"3co8A02" CATHEDRAL job SID2947392562964560 is not yet finished.

Flow stage update by auto on 19 Feb 2009 06:29

The entry "3co8A02" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 19 Feb 2009 06:29

The entry "3co8A02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 27 Jan 2009 12:06

Unable to retrieve "3co8A02" CATHEDRAL results for job "SID2050529365429416"

Update comment by auto on 22 Jan 2009 17:14

"3co8A02" CATHEDRAL job SID2050529365429416 is not yet finished.

Cathedral cath submit by auto on 22 Jan 2009 16:51

The entry "3co8A02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Jan 2009 16:51

The entry "3co8A02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 21 Dec 2008 15:11

ScanList with 12830 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3co8A02.scanlist" for "3co8A02"

Write scan list by auto on 21 Dec 2008 15:11

Writing ScanList containing 12830 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3co8A02.scanlist" for domain "3co8A02"

Update comment by auto on 21 Dec 2008 11:52

Waiting for 76 new domains (example : 3davB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 20:42

Waiting for 113 new domains (example : 3bmkB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 19:04

Waiting for 148 new domains (example : 3bllA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 14:36

Waiting for 197 new domains (example : 2vmtA02) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 11:36

Waiting for 239 new domains (example : 2jknF00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 07:50

Waiting for 256 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 03:59

Waiting for 248 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 00:50

Waiting for 246 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 20:43

Waiting for 197 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 16:56

Waiting for 189 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 11:35

Waiting for 32 new domains (example : 2jknA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 23:34

Waiting for 2 new domains (example : 3fcxA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 22:12

Waiting for 27 new domains (example : 3ex7B00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 17:38

Waiting for 80 new domains (example : 2zecD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 14:52

Waiting for 132 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 11:32

Waiting for 174 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 09:48

Waiting for 227 new domains (example : 2w42B01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 04:25

Waiting for 270 new domains (example : 2rklB00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 00:28

Waiting for 285 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 20:36

Waiting for 267 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 18:32

Waiting for 261 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 14:43

Waiting for 215 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 10:54

Waiting for 201 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Dec 2008 20:40

Waiting for 150 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Dec 2008 17:14

Waiting for 297 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Dec 2008 20:42

Waiting for 337 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Dec 2008 17:19

Waiting for 547 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Dec 2008 20:38

Waiting for 598 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Dec 2008 16:50

Waiting for 852 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Dec 2008 20:56

Waiting for 902 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Dec 2008 17:05

Waiting for 1430 new domains (example : 2nrfA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Dec 2008 14:48

Waiting for 1534 new domains (example : 2gqgA02) to be processed so that they can be scanned against too.

Flow stage update by auto on 10 Dec 2008 14:41

No satisfactory AssignClose result found.

Flow stage update by auto on 10 Dec 2008 14:17

No in_process hits for Domain "3co8A02" ready to be processed

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "3co8A02"

Flow stage update by auto on 05 Dec 2008 08:14

All required files are present for Domain "3co8A02"

Flow stage update by auto on 04 Dec 2008 17:23

Beginning processing for Domain "3co8A02"

Insertion by cuff on 04 Dec 2008 15:46

nice chopping