Domain assigned by auto on 10 Dec 2008 14:41
Assigning to "2.40.37.10" based on similarity with "1niuB02"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3co8A01 | 2 | 14 |
| 3co8A01 | 236 | 370 |
| 3co8A02 | 15 | 235 |
There are 1 matching structural neighberhood comparisons for CATH ID 2.40.37.10.3.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1vfsB01 | 88.96 | 2.40.37.10 | 147 | 27 | 90 | 2.12 | 2.34 |
>pdb|3co8A01 LEAIHRSTRIEFSLGPIDKLKPVFELKSALTFVKKIPAGEGISYGSKFVTSRDTWIGTLPIGYGDGWLAEYQDFQLLIDG QKCRQVGQIADQVALPHEYPIGTEVTLIGKSGKYENTLYDLHKHSGVPPWKITVAFSDRLKRVV
Assigning to "2.40.37.10" based on similarity with "1niuB02"
No in_process hits for Domain "3co8A01" ready to be processed
NW result present for Domain "3co8A01"
All required files are present for Domain "3co8A01"
Beginning processing for Domain "3co8A01"
nice chopping