CATH Domain: 3cnyA00

3cnyA00

PDB 3cny, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.20	Alpha-Beta Barrel
3.20.20	TIM Barrel
3.20.20.150	Divalent-metal-dependent TIM barrel enzymes	Gene3D
3.20.20.150.6
3.20.20.150.6.1
3.20.20.150.6.1.1
3.20.20.150.6.1.1.1
3.20.20.150.6.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 3cnyA00

Domain	Start PDB Residue	Stop PDB Residue
3cnyA00	2	300

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.20.20.150.6.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
3dx5A00	80.54	Bacillus anthracisPetrobactin biosynthesis protein AsbF	3.20.20.150	267	16	87	3.70	4.23
1k77A00	80.21	Protein ygbMProtein bindingEscherichia coli K-12	3.20.20.150	256	12	81	3.18	3.91
2q02A00	79.88	Inosose isomerase [EC:5.3.99.-]Salmonella enterica subsp. enterica serovar TyphimuriumPutative cytoplasmic protein	3.20.20.150	265	10	86	3.65	4.20
1yx1A00	75.81	Pseudomonas aeruginosaKguE	3.20.20.150	248	16	81	3.85	4.74

[top]
Domain ATOM Sequence

>pdb|3cnyA00
SSKAEKDIKWGIAPIGWRNDDIPSIGKDNNLQQLLSDIVVAGFQGTEVGGFFPGPEKLNYELKLRNLEIAGQWFSSYIIR
DGIEKASEAFEKHCQYLKAINAPVAVVSEQTYTIQRSDTANIFKDKPYFTDKEWDEVCKGLNHYGEIAAKYGLKVAYHHH
GTGIQTKEETDRLANTDPKLVGLLYDTGHIAVSDGDYALLNAHIDRVVHVHFKDVRRSKEEECRAKGLTFQGSFLNGFTV
PGDGDLDFKPVYDKLIANNYKGWIVVEAEQDPSKANPLEAQIAHRYIKQHLIEN

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|3cnyA00
GXSSKAEKDIKWGIAPIGWRNDDIPSIGKDNNLQQLLSDIVVAGFQGTEVGGFFPGPEKLNYELKLRNLEIAGQWFSSYI
IRDGIEKASEAFEKHCQYLKAINAPVAVVSEQTYTIQRSDTANIFKDKPYFTDKEWDEVCKGLNHYGEIAAKYGLKVAYH
HHXGTGIQTKEETDRLXANTDPKLVGLLYDTGHIAVSDGDYXALLNAHIDRVVHVHFKDVRRSKEEECRAKGLTFQGSFL
NGXFTVPGDGDLDFKPVYDKLIANNYKGWIVVEAEQDPSKANPLEXAQIAHRYIKQHLIEN

BLAST against CATH

[top]
Domain History Events (58)

Domain assigned by cuff on 01 Apr 2009 17:15

homology match

Domain assignment manual match h by cuff on 01 Apr 2009 17:14

same superfamily

Homcheck allotment by cuff on 01 Apr 2009 17:11

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 01 Apr 2009 17:11

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 19:30

Domain "3cnyA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 19:29

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cnyA00

Flow stage update by auto on 19 Mar 2009 16:57

Retrieved PRC_PFAMCATH results for job ID SID0368453817337873 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 16:56

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 32 results for 3cnyA00

Prc pfamcath submit by auto on 19 Mar 2009 13:55

The entry "3cnyA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 19 Mar 2009 13:55

The entry "3cnyA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 19 Mar 2009 13:47

Retrieved SSAP results for job ID SID8953892445374768 and results inserted.

Domain scan ssap cath by auto on 19 Mar 2009 13:46

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 432 results for 3cnyA00

Update comment by auto on 04 Mar 2009 09:25

SSAP job SID8953892445374768 is not yet finished.

Flow stage update by auto on 04 Mar 2009 09:08

The entry "3cnyA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 04 Mar 2009 09:08

The entry "3cnyA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:42

Retrieved PRC results for job ID SID6617813810804404 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 08:41

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 13 results for 3cnyA00

Prc cath submit by auto on 04 Mar 2009 06:32

The entry "3cnyA00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 06:32

The entry "3cnyA00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:49

Retrieved HMM(SAM) results for job ID SID5553325796009417 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:48

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 9 results for 3cnyA00

Update comment by auto on 04 Mar 2009 01:24

HMM(SAM) job SID5553325796009417 is not yet finished.

Sam cath submit by auto on 04 Mar 2009 00:00

The entry "3cnyA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 00:00

The entry "3cnyA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:16

Unable to retrieve "3cnyA00" HMM(SAM) results for job "SID0742474298471616"

Update comment by auto on 19 Feb 2009 08:47

HMM(SAM) job SID0742474298471616 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:23

The entry "3cnyA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:23

The entry "3cnyA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:28

Unable to retrieve "3cnyA00" HMM(SAM) results for job "SID4656558389678670"

Update comment by auto on 22 Jan 2009 17:56

HMM(SAM) job SID4656558389678670 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:42

The entry "3cnyA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:42

The entry "3cnyA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Dec 2008 04:45

Retrieved "3cnyA00" CATHEDRAL results for job ID SID1460073309042642 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Dec 2008 04:44

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 142 results for 3cnyA00