CATH Domain: 3cnxA00

There are 12 matching structural neighberhood comparisons for CATH ID 3.10.450.50.19.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	2ux0B00	86.48	Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiensCalcium- and calmodulin-dependent protein kinase complex	3.10.450.50	136	15	88	2.31	2.60
	2owpA00	86.07	Burkholderia xenovorans LB400Putative uncharacterized protein	3.10.450.50	124	19	85	2.44	2.84
	1m98A02	84.85	Arthrospira maximaOrange carotenoid-binding protein	3.10.450.50	128	11	85	3.88	4.52
	3bb9B00	83.88	Putative orphan proteinShewanella frigidimarina NCIMB 400	3.10.450.50	120	16	87	3.55	4.06
	1of5B00	82.21	Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae	3.10.450.50	128	6	85	2.64	3.10
	3cu3A00	80.49	Domain of unknown function with a cystatin-like foldNostoc punctiforme PCC 73102	3.10.450.50	160	13	76	3.15	4.10
	1of5A00	79.45	Nuclear poreStructural constituent of nuclear poreRNA bindingMRNA export factor MEX67MRNA export from nucleus	3.10.450.50	154	9	78	3.73	4.75
	2bmoB00	78.45	Oxygenase-beta NBDOComamonas sp. JS765Protein binding	3.10.450.50	194	7	63	2.67	4.18
	1jkgB00	77.91	Nuclear RNA export factor 1Homo sapiensProtein binding	3.10.450.50	180	11	67	2.87	4.27
	1q40D00	77.59	MRNA export factor MEX67Candida albicans	3.10.450.50	169	8	67	2.84	4.21
	1q42A00	77.50	MRNA transport regulator MTR2Candida albicans	3.10.450.50	159	11	76	3.26	4.28
	3b7cA00	77.45	Shewanella oneidensisPutative uncharacterized protein	3.10.450.50	115	10	80	3.59	4.45

>pdb|3cnxA00
TPDTDVEQVGLANTAFYEAERGDFETLSSLWLTPADLGVPADAGVVSCVHPGWPVLSGRGEVLRSYALIANTEYIQFFLT
DVHVSVTGDTALVTCTENILSGGGPLVGQLVVATNVFRRTPDGWKLWSHHASPVLA    

>pdb|3cnxA00
GXSTPTPDTDVEQVGLANTAFYEAXERGDFETLSSLWLTPADLGVDEEYHDPADAGVVSCVHPGWPVLSGRGEVLRSYAL
IXANTEYIQFFLTDVHVSVTGDTALVTCTENILSGGPPPDDSDELGPLVGQLVVATNVFRRTPDGWKLWSHHASPVLAET
GAEEGDESPD