CATH Domain: 3cnvA01 XML data for domain: 3cnvA01

Molscript image for 3cnvA01
3cnvA01
PDB coordinates for domain 3cnvA01

PDB 3cnv, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1410 Chorismate lyase
3.40.1410.10 Chorismate lyase Gene3D
3.40.1410.10.4
3.40.1410.10.4.1
3.40.1410.10.4.1.1
3.40.1410.10.4.1.1.1
3.40.1410.10.4.1.1.1.1

[top]
Segment boundaries for domain 3cnvA01

Chopping figure for domain 3cnvA01
DomainStart PDB ResidueStop PDB Residue
3cnvA01 98 258

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.40.1410.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ddvB01 88.77 GntR family transcriptional regulatorTranscriptional regulator, GntR familyEnterococcus faecalis 3.40.1410.10 137 19 88 1.95 2.20
3bwgC02 87.96 GntR family transcriptional regulator, transcriptional regulator of bglABacillus subtilisUncharacterized HTH-type transcriptional regulator yydK 3.40.1410.10 155 16 94 3.41 3.62
2p19A01 87.65 Corynebacterium glutamicumBacterial regulatory proteins, gntR family 3.40.1410.10 130 34 84 1.85 2.20
2pkhB01 86.23 Pseudomonas syringae pv. tomatoHistidine utilization repressorGntR family transcriptional regulator, histidine utilization repressor 3.40.1410.10 129 16 84 2.42 2.86
2oggA01 84.36 GntR family transcriptional regulator, trehalose operon transcriptional repressorBacillus subtilisTrehalose operon transcriptional repressor 3.40.1410.10 133 15 86 2.50 2.91
2nwiB00 83.63 Archaeoglobus fulgidusPutative uncharacterized protein 3.40.1410.10 151 14 86 3.32 3.83
3eetB02 83.41 Streptomyces avermitilisPutative GntR-family transcriptional regulator 3.40.1410.10 161 16 91 3.58 3.92
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3cnvA01
VRYRFLRLAPDEAESRILECRRLRAPAEIARALELRAGETVVTIRRQLSNHPTVIDDLWLPGTHFRGLTLELLTASKAPL
YGLFESEFGVSVRADEKLRAVAASPEIAPLLGVEPGRPLLQVDRISYTYGDRPEVRRGLYLTDHYHYRNSL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3cnvA01
VRYRFLRLAPDEEGEGGRAESRILECRRLRAPAEIARALELRAGETVVTIRRQLSXNHXPTVIDDLWLPGTHFRGLTLEL
LTASKAPLYGLFESEFGVSXVRADEKLRAVAASPEIAPLLGVEPGRPLLQVDRISYTYGDRPXEVRRGLYLTDHYHYRNS
L
BLAST against CATH

[top]
Domain History Events (53)

Domain assigned by cuff on 01 Apr 2009 17:01

homology match

Domain assignment manual match h by cuff on 01 Apr 2009 17:00

same superfamily

Homcheck allotment by cuff on 01 Apr 2009 16:58

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 01 Apr 2009 16:58

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 19:30

Domain "3cnvA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 19:30

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cnvA01

Flow stage update by auto on 19 Mar 2009 16:58

Retrieved PRC_PFAMCATH results for job ID SID5155779475769696 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 16:57

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 15 results for 3cnvA01

Update comment by auto on 09 Mar 2009 13:45

PRC_PFAMCATH job SID5155779475769696 is not yet finished.

Flow stage update by auto on 09 Mar 2009 13:25

The entry "3cnvA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 09 Mar 2009 13:25

The entry "3cnvA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 09 Mar 2009 13:23

Retrieved SSAP results for job ID SID1795296680567182 and results inserted.

Domain scan ssap cath by auto on 09 Mar 2009 13:22

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1304 results for 3cnvA01

Update comment by auto on 04 Mar 2009 09:25

SSAP job SID1795296680567182 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 09:08

The entry "3cnvA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 09:08

The entry "3cnvA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:43

Retrieved PRC results for job ID SID5288105872960956 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 08:42

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 9 results for 3cnvA01

Prc cath submit by auto on 04 Mar 2009 06:32

The entry "3cnvA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 06:32

The entry "3cnvA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:49

Retrieved HMM(SAM) results for job ID SID5990931520604289 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:49

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 7 results for 3cnvA01

Update comment by auto on 04 Mar 2009 01:24

HMM(SAM) job SID5990931520604289 is not yet finished.

Sam cath submit by auto on 04 Mar 2009 00:00

The entry "3cnvA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 00:00

The entry "3cnvA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:16

Unable to retrieve "3cnvA01" HMM(SAM) results for job "SID8391809242701856"

Sam cath submit by auto on 19 Feb 2009 15:27

The entry "3cnvA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 15:27

The entry "3cnvA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 13:43

Retrieved "3cnvA01" CATHEDRAL results for job ID SID3226399452550496 and inserted them into the database.

Domain scan cathedral cath by auto on 19 Feb 2009 13:42

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 198 results for 3cnvA01

Update comment by auto on 19 Feb 2009 07:44

"3cnvA01" CATHEDRAL job SID3226399452550496 is not yet finished.

Cathedral cath submit by auto on 19 Feb 2009 06:29

The entry "3cnvA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 19 Feb 2009 06:29

The entry "3cnvA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 27 Jan 2009 12:06

Unable to retrieve "3cnvA01" CATHEDRAL results for job "SID9046639166261538"

Update comment by auto on 22 Jan 2009 17:14

"3cnvA01" CATHEDRAL job SID9046639166261538 is not yet finished.

Cathedral cath submit by auto on 22 Jan 2009 16:50

The entry "3cnvA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Jan 2009 16:50

The entry "3cnvA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 10 Dec 2008 14:49

Unable to retrieve "3cnvA01" CATHEDRAL results for job "SID0029622633156512"

Update comment by auto on 03 Dec 2008 14:53

"3cnvA01" CATHEDRAL job SID0029622633156512 is not yet finished.

Cathedral cath submit by auto on 03 Dec 2008 14:46

The entry "3cnvA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 14:46

The entry "3cnvA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 10:44

Unable to retrieve "3cnvA01" CATHEDRAL results for job "SID7278870818780552"

Update comment by auto on 03 Dec 2008 01:07

"3cnvA01" CATHEDRAL job SID7278870818780552 is not yet finished.

Cathedral cath submit by auto on 03 Dec 2008 00:35

The entry "3cnvA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 00:35

The entry "3cnvA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 00:05

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3cnvA01.scanlist" for "3cnvA01"

Write scan list by auto on 03 Dec 2008 00:04

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3cnvA01.scanlist" for domain "3cnvA01"

Flow stage update by auto on 02 Dec 2008 23:28

No satisfactory AssignClose result found.

Flow stage update by auto on 02 Dec 2008 23:09

No in_process hits for Domain "3cnvA01" ready to be processed

Flow stage update by auto on 02 Dec 2008 23:09

NW result present for Domain "3cnvA01"

Flow stage update by auto on 02 Dec 2008 11:08

All required files are present for Domain "3cnvA01"

Flow stage update by auto on 01 Dec 2008 17:53

Beginning processing for Domain "3cnvA01"

Insertion by cuff on 01 Dec 2008 16:41

nice chopping