CATH Domain: 3cnhB02 XML data for domain: 3cnhB02

Molscript image for 3cnhB02
3cnhB02
PDB coordinates for domain 3cnhB02

PDB 3cnh, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.240 Putative phosphatase; domain 2 Gene3D
1.10.150.240.9
1.10.150.240.9.1
1.10.150.240.9.1.1
1.10.150.240.9.1.1.1
1.10.150.240.9.1.1.1.1

[top]
Segment boundaries for domain 3cnhB02

Chopping figure for domain 3cnhB02
DomainStart PDB ResidueStop PDB Residue
3cnhB01 2 17
3cnhB01 86 199
3cnhB02 18 85

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.10.150.240.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2b0cA02 80.25 Phosphatase yihXGlucose-1-phosphatase activityPutative hydrolase of the HAD superfamilyEscherichia coli K-12 1.10.150.240 66 14 80 2.62 3.26
2ah5A02 79.47 Glyoxylate and dicarboxylate metabolismMetabolic pathwaysPhosphoglycolate phosphatase [EC:3.1.3.18]Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 1.10.150.240 64 5 71 3.08 4.29
2nyvA02 72.32 Phosphoglycolate phosphatase [EC:3.1.3.18]Metabolic pathwaysGlyoxylate and dicarboxylate metabolismAquifex aeolicusPhosphoglycolate phosphatase 1.10.150.240 64 8 79 3.61 4.53
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3cnhB02
GWDREQRADVAQRFGLDTDDFTERHRLAAPELELGRTLAEYLEQVVFYQPRDFTPEDFRAVEEQSQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3cnhB02
GWDREQRADVAQRFGLDTDDFTERHRLAAPELELGRXTLAEYLEQVVFYQPRDFTPEDFRAVXEEQSQ
BLAST against CATH

[top]
Domain History Events (9)

Classification merge by cuff on 12 Nov 2010 19:13

COMMENT: merge fold and superfamily FINAL: merge: 1.10.164.10 --> 1.10.150.240

Domain assigned by auto on 06 May 2009 20:32

Assigning to "1.10.164.10" based on similarity with "3cnhA02"

Flow stage update by auto on 06 May 2009 20:11

No in_process hits for Domain "3cnhB02" ready to be processed

Update comment by auto on 02 Dec 2008 23:11

Domain "3cnhB02" hits Domain "3cnhA02" (97.0149253731343% over 98.5294117647059%) which is currently in process

Flow stage update by auto on 02 Dec 2008 23:09

Domain "3cnhB02" hits Domain "3cnhA02" (97.0149253731343% over 98.5294117647059%) which is currently in process

Flow stage update by auto on 02 Dec 2008 23:09

NW result present for Domain "3cnhB02"

Flow stage update by auto on 02 Dec 2008 11:08

All required files are present for Domain "3cnhB02"

Flow stage update by auto on 01 Dec 2008 17:53

Beginning processing for Domain "3cnhB02"

Insertion by auto on 01 Dec 2008 17:16

Final ChopClose added based on similarity with "3cnhA"