CATH Domain: 3cmgA04

3cmgA04

PDB 3cmg, Chain A, Domain 4

CATH Code	Level Description	Links
2	Mainly Beta
2.60	Sandwich
2.60.40	Immunoglobulin-like
2.60.40.1560	E-set domains of sugar-utilizing enzymes; domain 3	Gene3D
2.60.40.1560.1
2.60.40.1560.1.1
2.60.40.1560.1.1.1
2.60.40.1560.1.1.1.1
2.60.40.1560.1.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 3cmgA04

Domain	Start PDB Residue	Stop PDB Residue
3cmgA01	36	183
3cmgA02	184	301
3cmgA03	302	609
3cmgA04	610	698

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 2.60.40.1560.1.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1ulvA03	84.93	GlucodextranaseArthrobacter globiformis	2.60.40.1560	86	17	88	2.27	2.56

[top]
Domain ATOM Sequence

>pdb|3cmgA04
MIYLAEKRCRLRYQPEQTFMAFTTAPEAELFVNGVSCGKQKADTYSTVVWKNVKLTSGENIIRVTTPGKKPLTDEVTVEY
KEDRHHH

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|3cmgA04
MIYLAEKRCRLRYQPEQTFMAFTTAPEAELFVNGVSCGKQKADTYSTVVWKNVKLTSGENIIRVTTPGKKPLTDEVTVEY
KEDREGHHHHHH

BLAST against CATH

[top]
Domain History Events (59)

Domain assigned by cuff on 01 Apr 2009 16:24

superfamily match

Domain assignment manual match h by cuff on 01 Apr 2009 16:22

same superfamily

Homcheck allotment by cuff on 01 Apr 2009 16:21

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 01 Apr 2009 16:21

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 19:21

Domain "3cmgA04" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 19:20

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cmgA04

Flow stage update by auto on 19 Mar 2009 16:46

Retrieved PRC_PFAMCATH results for job ID SID7636218558974196 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 16:45

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 3cmgA04

Update comment by auto on 08 Mar 2009 19:28

PRC_PFAMCATH job SID7636218558974196 is not yet finished.

Prc pfamcath submit by auto on 08 Mar 2009 19:10

The entry "3cmgA04" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Mar 2009 19:10

The entry "3cmgA04" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Mar 2009 19:05

Retrieved SSAP results for job ID SID6743831014679600 and results inserted.

Domain scan ssap cath by auto on 08 Mar 2009 18:59

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2491 results for 3cmgA04

Update comment by auto on 04 Mar 2009 09:25

SSAP job SID6743831014679600 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 09:07

The entry "3cmgA04" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 09:07

The entry "3cmgA04" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:36

Retrieved PRC results for job ID SID6939130777643880 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 08:35

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 3cmgA04

Prc cath submit by auto on 04 Mar 2009 06:30

The entry "3cmgA04" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 06:30

The entry "3cmgA04" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:43

Retrieved HMM(SAM) results for job ID SID7106996742876802 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:42

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3cmgA04

Update comment by auto on 04 Mar 2009 01:23

HMM(SAM) job SID7106996742876802 is not yet finished.

Sam cath submit by auto on 03 Mar 2009 23:58

The entry "3cmgA04" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:58

The entry "3cmgA04" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:15

Unable to retrieve "3cmgA04" HMM(SAM) results for job "SID1001939856314464"

Update comment by auto on 19 Feb 2009 08:46

HMM(SAM) job SID1001939856314464 is not yet finished.

Flow stage update by auto on 19 Feb 2009 08:22

The entry "3cmgA04" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 19 Feb 2009 08:22

The entry "3cmgA04" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:27

Unable to retrieve "3cmgA04" HMM(SAM) results for job "SID5052609481438736"

Update comment by auto on 22 Jan 2009 17:56

HMM(SAM) job SID5052609481438736 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:41

The entry "3cmgA04" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:41

The entry "3cmgA04" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Dec 2008 04:33

Retrieved "3cmgA04" CATHEDRAL results for job ID SID6521106505677904 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Dec 2008 04:31

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 195 results for 3cmgA04