CATH Domain: 3cmgA02 XML data for domain: 3cmgA02

Molscript image for 3cmgA02
3cmgA02
PDB coordinates for domain 3cmgA02

PDB 3cmg, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.40 Immunoglobulin-like
2.60.40.320 Gene3D
2.60.40.320.6
2.60.40.320.6.1
2.60.40.320.6.1.1
2.60.40.320.6.1.1.1
2.60.40.320.6.1.1.1.1

[top]
Segment boundaries for domain 3cmgA02

Chopping figure for domain 3cmgA02
DomainStart PDB ResidueStop PDB Residue
3cmgA01 36 183
3cmgA02 184 301
3cmgA03 302 609
3cmgA04 610 698

Structural Neighbourhood (12 entries)

There are 12 matching structural neighberhood comparisons for CATH ID 2.60.40.320.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 12 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3bgaA04 79.82 Galactose metabolismBacteroides thetaiotaomicronBeta-galactosidaseSphingolipid metabolismBeta-galactosidase [EC:3.2.1.23] 2.60.40.320 105 7 79 2.99 3.75
1kshB00 79.53 Purine metabolismVisual perceptionRetinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit deltaHomo sapiensRetinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta 2.70.50.40 141 7 73 3.16 4.33
1xvsA00 79.12 Vibrio choleraeProtein ApaGApaG protein 2.60.40.1470 120 9 82 3.36 4.07
2r5oA01 78.87 Putative ATP binding component of ABC-transporterEscherichia coli 2.70.50.60 151 8 68 2.51 3.68
2qfpA01 77.61 Fe(3+)-Zn(2+) purple acid phosphatasePhaseolus vulgaris 2.60.40.380 97 6 74 3.29 4.41
1f00I01 77.36 Pathogenic Escherichia coli infectionIntiminIntiminProtein bindingEscherichia coli O127:H6 str. E2348/69 2.60.40.920 95 11 75 3.49 4.63
1kmtA00 77.24 Anti-apoptosisCellular component movementIdentical protein bindingCytoskeletonNeurotrophin signaling pathway 2.70.50.30 138 9 73 3.51 4.75
1cwvA03 76.83 InvasinYersinia pseudotuberculosis 2.60.40.920 102 1 78 3.73 4.73
1ayoA00 76.83 Bos taurusAlpha-2-macroglobulinAlpha-2-macroglobulinComplement and coagulation cascades 2.60.40.690 130 5 75 3.65 4.84
1rocA00 76.37 Positive regulation of histone acetylationRegulation of transcription from RNA polymerase II promoter in response to stressChromatin silencing at silent mating-type cassetteDNA replication-dependent nucleosome assemblyChromatin silencing at telomere 2.60.40.1490 155 8 67 3.12 4.61
1nepA00 75.67 LysosomeBos taurusNiemann-Pick C2 proteinEpididymal secretory protein E1 2.60.40.770 130 10 76 3.12 4.06
2nt0A02 72.68 GlucosylceramidaseProtein bindingSphingolipid metabolismGlucosylceramidase [EC:3.2.1.45]Metabolic pathways 2.60.40.1180 109 4 45 1.90 4.15
[1]
Displaying entries 1 to 12 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3cmgA02
ETCISPLDYASPGVYLVQEVVSPQEAKVCAKVNLSNRAADGTAELQVLVTDGTKVICKESRNVSLKQGADILEQLPLLIQ
KPRLWNGCEDPFMYQVSISLHKDGKQIDSVTQPLGLRY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3cmgA02
ETCISPLDYASPGVYLVQEVVSPQEAKVCAKVNLSNRAADGTAELQVLVTDGTKVICKESRNVSLKQGADILEQLPLLIQ
KPRLWNGCEDPFMYQVSISLHKDGKQIDSVTQPLGLRY
BLAST against CATH

[top]
Domain History Events (59)

Domain assigned by cuff on 17 Apr 2009 11:39

superfamily match

Domain assignment manual match h by cuff on 17 Apr 2009 11:37

same superfamily

Homcheck allotment by cuff on 01 Apr 2009 16:16

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 01 Apr 2009 16:16

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 19:23

Domain "3cmgA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 19:23

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cmgA02

Flow stage update by auto on 19 Mar 2009 16:49

Retrieved PRC_PFAMCATH results for job ID SID4971896052565616 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 16:48

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 7 results for 3cmgA02

Update comment by auto on 08 Mar 2009 23:55

PRC_PFAMCATH job SID4971896052565616 is not yet finished.

Prc pfamcath submit by auto on 08 Mar 2009 23:34

The entry "3cmgA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Mar 2009 23:34

The entry "3cmgA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Mar 2009 23:26

Retrieved SSAP results for job ID SID9453460508896928 and results inserted.

Domain scan ssap cath by auto on 08 Mar 2009 23:22

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2445 results for 3cmgA02

Update comment by auto on 04 Mar 2009 09:24

SSAP job SID9453460508896928 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 09:07

The entry "3cmgA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 09:07

The entry "3cmgA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:34

Retrieved PRC results for job ID SID5292545923565618 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 08:33

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 7 results for 3cmgA02

Prc cath submit by auto on 04 Mar 2009 06:30

The entry "3cmgA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 06:30

The entry "3cmgA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:42

Retrieved HMM(SAM) results for job ID SID1013520527167516 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:41

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 3cmgA02

Update comment by auto on 04 Mar 2009 01:23

HMM(SAM) job SID1013520527167516 is not yet finished.

Sam cath submit by auto on 03 Mar 2009 23:58

The entry "3cmgA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:58

The entry "3cmgA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:14

Unable to retrieve "3cmgA02" HMM(SAM) results for job "SID3919967313718528"

Update comment by auto on 19 Feb 2009 08:46

HMM(SAM) job SID3919967313718528 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:22

The entry "3cmgA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:22

The entry "3cmgA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:27

Unable to retrieve "3cmgA02" HMM(SAM) results for job "SID3709960335004888"

Update comment by auto on 22 Jan 2009 17:56

HMM(SAM) job SID3709960335004888 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:40

The entry "3cmgA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:40

The entry "3cmgA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Dec 2008 04:30

Retrieved "3cmgA02" CATHEDRAL results for job ID SID8224019179533616 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Dec 2008 04:28

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 195 results for 3cmgA02

Update comment by auto on 03 Dec 2008 23:46

"3cmgA02" CATHEDRAL job SID8224019179533616 is not yet finished.

Flow stage update by auto on 03 Dec 2008 23:40

The entry "3cmgA02" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Dec 2008 23:40

The entry "3cmgA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 20:56

Unable to retrieve "3cmgA02" CATHEDRAL results for job "SID5138705825884422"

Cathedral cath submit by auto on 03 Dec 2008 20:49

The entry "3cmgA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 20:49

The entry "3cmgA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 17:52

Unable to retrieve "3cmgA02" CATHEDRAL results for job "SID3675412628016384"

Cathedral cath submit by auto on 03 Dec 2008 17:47

The entry "3cmgA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 17:47

The entry "3cmgA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 14:52

Unable to retrieve "3cmgA02" CATHEDRAL results for job "SID4944435761406492"

Cathedral cath submit by auto on 03 Dec 2008 14:40

The entry "3cmgA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 14:40

The entry "3cmgA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 10:43

Unable to retrieve "3cmgA02" CATHEDRAL results for job "SID0791792517407880"

Update comment by auto on 03 Dec 2008 01:06

"3cmgA02" CATHEDRAL job SID0791792517407880 is not yet finished.

Cathedral cath submit by auto on 03 Dec 2008 00:33

The entry "3cmgA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 00:33

The entry "3cmgA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 00:02

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3cmgA02.scanlist" for "3cmgA02"

Write scan list by auto on 03 Dec 2008 00:02

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3cmgA02.scanlist" for domain "3cmgA02"

Flow stage update by auto on 02 Dec 2008 23:27

No satisfactory AssignClose result found.

Flow stage update by auto on 02 Dec 2008 23:09

No in_process hits for Domain "3cmgA02" ready to be processed

Flow stage update by auto on 02 Dec 2008 23:09

NW result present for Domain "3cmgA02"

Flow stage update by auto on 02 Dec 2008 11:08

All required files are present for Domain "3cmgA02"

Flow stage update by auto on 01 Dec 2008 17:53

Beginning processing for Domain "3cmgA02"

Insertion by cuff on 01 Dec 2008 16:41

nice chopping