CATH Domain: 3ck2A00

3ck2A00

PDB 3ck2, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.60	4-Layer Sandwich
3.60.21	Purple Acid Phosphatase; chain A, domain 2
3.60.21.10		Gene3D
3.60.21.10.18
3.60.21.10.18.1
3.60.21.10.18.1.1
3.60.21.10.18.1.1.1
3.60.21.10.18.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 3ck2A00

Domain	Start PDB Residue	Stop PDB Residue
3ck2A00	0	173

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.60.21.10.18.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1s3lA00	83.58	Methanocaldococcus jannaschiiPhosphodiesterase MJ0936	3.60.21.10	165	17	84	2.65	3.15

[top]
Domain ATOM Sequence

>pdb|3ck2A00
AAKQTIIVSDSHGDSLIVEEVRDRYVGKVDAVFHNGDSELRPDSPLWEGIRVVKGNDFYAGYPERLVTELGSTKIIQTHG
HLFDINFNFQKLDYWAQEEEAAICLYGHLHVPSAWLEGKILFLNPGSISQPRGTIRECLYARVEIDDSYFKVDFLTRDHE
VYPGLSKEFSR

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|3ck2A00
SNAXAKQTIIVXSDSHGDSLIVEEVRDRYVGKVDAVFHNGDSELRPDSPLWEGIRVVKGNXDFYAGYPERLVTELGSTKI
IQTHGHLFDINFNFQKLDYWAQEEEAAICLYGHLHVPSAWLEGKILFLNPGSISQPRGTIRECLYARVEIDDSYFKVDFL
TRDHEVYPGLSKEFSR

BLAST against CATH

[top]
Domain History Events (60)

Domain assigned by cuff on 01 Apr 2009 11:54

homology match

Domain assignment manual match h by cuff on 01 Apr 2009 11:53

superfamily match

Homcheck allotment by cuff on 01 Apr 2009 11:52

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 01 Apr 2009 11:52

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 19:14

Domain "3ck2A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 19:14

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3ck2A00

Flow stage update by auto on 19 Mar 2009 16:39

Retrieved PRC_PFAMCATH results for job ID SID0602083481590784 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 16:38

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 18 results for 3ck2A00

Update comment by auto on 08 Mar 2009 23:54

PRC_PFAMCATH job SID0602083481590784 is not yet finished.

Flow stage update by auto on 08 Mar 2009 23:34

The entry "3ck2A00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 08 Mar 2009 23:33

The entry "3ck2A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Mar 2009 23:15

Retrieved SSAP results for job ID SID2711459508990512 and results inserted.

Domain scan ssap cath by auto on 08 Mar 2009 23:12

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1094 results for 3ck2A00

Update comment by auto on 04 Mar 2009 09:24

SSAP job SID2711459508990512 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 09:06

The entry "3ck2A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 09:06

The entry "3ck2A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:27

Retrieved PRC results for job ID SID4069970183408562 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 08:27

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 16 results for 3ck2A00

Prc cath submit by auto on 04 Mar 2009 06:28

The entry "3ck2A00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 06:28

The entry "3ck2A00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:36

Retrieved HMM(SAM) results for job ID SID5857766888777398 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:35

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 5 results for 3ck2A00

Update comment by auto on 04 Mar 2009 01:21

HMM(SAM) job SID5857766888777398 is not yet finished.

Sam cath submit by auto on 03 Mar 2009 23:56

The entry "3ck2A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:56

The entry "3ck2A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:13

Unable to retrieve "3ck2A00" HMM(SAM) results for job "SID7638351651103008"

Update comment by auto on 19 Feb 2009 08:45

HMM(SAM) job SID7638351651103008 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:20

The entry "3ck2A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:20

The entry "3ck2A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:26

Unable to retrieve "3ck2A00" HMM(SAM) results for job "SID9811900191718240"

Update comment by auto on 22 Jan 2009 17:55

HMM(SAM) job SID9811900191718240 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:40

The entry "3ck2A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:40

The entry "3ck2A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Dec 2008 04:12

Retrieved "3ck2A00" CATHEDRAL results for job ID SID8950261164881152 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Dec 2008 04:11

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 146 results for 3ck2A00