Domain assigned by cuff on 01 Apr 2009 11:51
same superfamily
| CATH Code | Level Description | Links |
|---|---|---|
3
| Alpha Beta | |
3.10
| Roll | |
3.10.129
| Thiol Ester Dehydrase; Chain A | |
3.10.129.10
| Gene3D | |
3.10.129.10.8
| ||
3.10.129.10.8.1
| ||
3.10.129.10.8.1.1
| ||
3.10.129.10.8.1.1.1
| ||
3.10.129.10.8.1.1.1.1
|
There are 28 matching structural neighberhood comparisons for CATH ID 3.10.129.10.8.1.1.1.1 (SIMAX score < 5)
>pdb|3ck1A00 GTAVFRNTVLVRFKHCDAAGIVFYPRYFELNDFIEDWFAQALDWPFDAHGAGQAGVPTADLHCRFVAPSRLGETLTRELR VVKLGQSSFTVQVRFGPDSGLRLEVTQRLVCVDTDKIAPRPLPDPVRQAATYVDETLA
same superfamily
same superfamily
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "3ck1A00" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3ck1A00
Retrieved PRC_PFAMCATH results for job ID SID6918024280036264 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 84 results for 3ck1A00
PRC_PFAMCATH job SID6918024280036264 is not yet finished.
The entry "3ck1A00" has been submitted to the PRC_PFAMCATH webservice.
The entry "3ck1A00" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID0929647061042856 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1336 results for 3ck1A00
SSAP job SID0929647061042856 is not yet finished.
The entry "3ck1A00" has been submitted to the SSAP webservice.
The entry "3ck1A00" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID3256316772604276 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 46 results for 3ck1A00
The entry "3ck1A00" has been submitted to the PRC webservice.
The entry "3ck1A00" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID1156913228056414 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 18 results for 3ck1A00
HMM(SAM) job SID1156913228056414 is not yet finished.
The entry "3ck1A00" has been submitted to the HMM (SAM) webservice.
The entry "3ck1A00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "3ck1A00" HMM(SAM) results for job "SID3495883206974570"
HMM(SAM) job SID3495883206974570 is not yet finished.
The entry "3ck1A00" has been submitted to the HMM (SAM) webservice.
The entry "3ck1A00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "3ck1A00" HMM(SAM) results for job "SID0566927728320288"
HMM(SAM) job SID0566927728320288 is not yet finished.
The entry "3ck1A00" has been submitted to the HMM (SAM) webservice.
The entry "3ck1A00" has been submitted to the HMM (SAM) webservice.
Retrieved "3ck1A00" CATHEDRAL results for job ID SID1428545044119904 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 19 results for 3ck1A00
"3ck1A00" CATHEDRAL job SID1428545044119904 is not yet finished.
The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.
The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.
Unable to retrieve "3ck1A00" CATHEDRAL results for job "SID0007910321814456"
The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.
The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.
Unable to retrieve "3ck1A00" CATHEDRAL results for job "SID8417835513699584"
The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.
The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.
Unable to retrieve "3ck1A00" CATHEDRAL results for job "SID1510221996255516"
The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.
The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.
Unable to retrieve "3ck1A00" CATHEDRAL results for job "SID5048006393034880"
"3ck1A00" CATHEDRAL job SID5048006393034880 is not yet finished.
The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.
The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.
ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3ck1A00.scanlist" for "3ck1A00"
Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3ck1A00.scanlist" for domain "3ck1A00"
Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "3ck1A00" ready to be processed
NW result present for Domain "3ck1A00"
All required files are present for Domain "3ck1A00"
Beginning processing for Domain "3ck1A00"
nice chopping