CATH Domain: 3ck1A00 XML data for domain: 3ck1A00

Molscript image for 3ck1A00
3ck1A00
PDB coordinates for domain 3ck1A00

PDB 3ck1, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.129 Thiol Ester Dehydrase; Chain A
3.10.129.10 Gene3D
3.10.129.10.8
3.10.129.10.8.1
3.10.129.10.8.1.1
3.10.129.10.8.1.1.1
3.10.129.10.8.1.1.1.1

Segment boundaries for domain 3ck1A00

Chopping figure for domain 3ck1A00
DomainStart PDB ResidueStop PDB Residue
3ck1A00 0 142

Structural Neighbourhood (28 entries)

There are 28 matching structural neighberhood comparisons for CATH ID 3.10.129.10.8.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 28 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1s5uE00 89.87 Protein bindingEscherichia coli K-12Acyl-CoA thioester hydrolase ybgC 3.10.129.10 136 22 94 1.92 2.02
2o5uC00 87.56 Pseudomonas aeruginosaPutative uncharacterized protein 3.10.129.10 140 16 94 1.92 2.04
2oiwA00 87.39 Geobacillus kaustophilusHypothetical conserved protein 3.10.129.10 129 16 92 2.24 2.43
2aliA00 87.16 Pseudomonas aeruginosaPutative uncharacterized protein 3.10.129.10 126 23 89 1.74 1.95
1njkA00 86.93 Long-chain acyl-CoA thioesterase tesCAcyl-CoA thioesterase activityThioesterase III [EC:3.1.2.-]Fatty acid beta-oxidationEscherichia coli K-12 3.10.129.10 130 16 91 2.95 3.23
2hljA01 86.54 Pseudomonas putida KT2440Putative uncharacterized protein 3.10.129.10 132 12 92 3.00 3.23
2oafA00 86.47 Jannaschia sp. CCS1Thioesterase superfamily 3.10.129.10 135 19 94 2.22 2.34
2nujA01 84.90 Jannaschia sp. CCS1Thioesterase superfamily 3.10.129.10 145 20 88 2.33 2.64
3bjkD00 84.13 Acyl-CoA thioesterase YciA [EC:3.1.2.-]Haemophilus influenzaeBiosynthesis of unsaturated fatty acidsUncharacterized acyl-CoA thioester hydrolase HI_0827 3.10.129.10 139 15 89 2.98 3.34
2fs2B00 82.95 Acyl-coenzyme A thioesterase paaIPhenylacetic acid degradation proteinEscherichia coli K-12 3.10.129.10 134 8 75 3.43 4.55
1wluA00 82.67 Thermus thermophilus HB8Phenylacetic acid degradation protein PaaIPhenylacetic acid degradation protein 3.10.129.10 117 10 72 2.69 3.71
2q2bA00 81.85 Mus musculusCytosolic acyl coenzyme A thioester hydrolaseFatty acid catabolic processPalmitoyl-CoA hydrolase activity 3.10.129.10 141 11 82 2.94 3.54
2essA02 81.72 Bacteroides thetaiotaomicronAcyl-ACP thioesterase 3.10.129.10 94 15 65 2.79 4.28
2pimA00 81.68 Ralstonia eutropha JMP134Phenylacetic acid degradation-related protein 3.10.129.10 127 14 71 2.53 3.53
1ixlA00 81.64 Putative uncharacterized protein PH1136Pyrococcus horikoshii 3.10.129.10 127 11 75 3.18 4.22
2essA01 81.36 Bacteroides thetaiotaomicronAcyl-ACP thioesterase 3.10.129.10 138 7 90 3.71 4.10
1z6bC00 81.14 Fatty acid biosynthesisMetabolic pathways3R-hydroxymyristoyl ACP dehydrase [EC:4.2.1.-]Plasmodium falciparumBeta-hydroxyacyl-ACP dehydratase 3.10.129.10 138 8 72 2.49 3.44
1zkiA00 80.93 Pseudomonas aeruginosaPhenylacetic acid degradation proteinPutative uncharacterized protein 3.10.129.10 118 10 71 2.84 4.00
3b7kA02 80.46 Acetyl-CoA hydrolase [EC:3.1.2.1]Pyruvate metabolismHomo sapiensAcyl-coenzyme A thioesterase 12 3.10.129.10 121 12 79 3.34 4.19
2prxA00 80.11 Shewanella loihica PV-4Thioesterase superfamily protein 3.10.129.10 108 12 66 2.61 3.92
2hboA01 79.93 Caulobacter vibrioidesPutative uncharacterized protein 3.10.129.10 126 12 71 3.31 4.61
2qwzA01 79.92 Phenylacetic acid degradation-related proteinRuegeria sp. TM1040 3.10.129.10 128 12 73 3.14 4.25
3b7kB01 79.63 Acetyl-CoA hydrolase [EC:3.1.2.1]Pyruvate metabolismHomo sapiensAcyl-coenzyme A thioesterase 12 3.10.129.10 140 7 81 3.78 4.64
1q6wG00 79.49 Monoamine oxidase regulatory protein, putativeArchaeoglobus fulgidus 3.10.129.10 147 9 72 2.77 3.84
1tbuB00 79.22 Palmitoyl-CoA hydrolase [EC:3.1.2.2]Protein bindingBiosynthesis of unsaturated fatty acidsPeroxisomal acyl-coenzyme A thioester hydrolase 1Peroxisome 3.10.129.10 98 9 65 3.19 4.84
1pn2D02 77.32 Candida tropicalisPeroxisomal hydratase-dehydrogenase-epimerase 3.10.129.10 122 13 65 2.59 3.97
3b7kC02 77.15 Acetyl-CoA hydrolase [EC:3.1.2.1]Pyruvate metabolismHomo sapiensAcyl-coenzyme A thioesterase 12 3.10.129.10 110 15 73 3.42 4.63
1mkaA00 75.57 Fatty acid biosynthesisMetabolic pathways3-hydroxydecanoyl-[acyl-carrier-protein] dehydrataseFatty acid biosynthetic process3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.60] 3.10.129.10 171 3 63 2.82 4.42
Displaying entries 1 to 28 (page 1 of 1)


Domain ATOM Sequence

>pdb|3ck1A00
GTAVFRNTVLVRFKHCDAAGIVFYPRYFELNDFIEDWFAQALDWPFDAHGAGQAGVPTADLHCRFVAPSRLGETLTRELR
VVKLGQSSFTVQVRFGPDSGLRLEVTQRLVCVDTDKIAPRPLPDPVRQAATYVDETLA    

Domain COMBS Sequence

>pdb|3ck1A00
GXTAVFRNTVLVRFKHCDAAGIVFYPRYFEXLNDFIEDWFAQALDWPFDAXHGAGQAGVPTADLHCRFVAPSRLGETLTR
ELRVVKLGQSSFTVQVRFXGPDSGLRLEVTQRLVCVDTDKIAPRPLPDPVRQAXATYVDETLAATGSPGL    

Domain History Events (60)

Domain assigned by cuff on 01 Apr 2009 11:51

same superfamily

Domain assignment manual match h by cuff on 01 Apr 2009 11:50

same superfamily

Homcheck allotment by cuff on 01 Apr 2009 11:48

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 01 Apr 2009 11:48

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 19:16

Domain "3ck1A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 19:15

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3ck1A00

Flow stage update by auto on 19 Mar 2009 16:41

Retrieved PRC_PFAMCATH results for job ID SID6918024280036264 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 16:40

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 84 results for 3ck1A00

Update comment by auto on 08 Mar 2009 19:28

PRC_PFAMCATH job SID6918024280036264 is not yet finished.

Prc pfamcath submit by auto on 08 Mar 2009 19:10

The entry "3ck1A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Mar 2009 19:10

The entry "3ck1A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Mar 2009 18:59

Retrieved SSAP results for job ID SID0929647061042856 and results inserted.

Domain scan ssap cath by auto on 08 Mar 2009 18:55

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1336 results for 3ck1A00

Update comment by auto on 04 Mar 2009 09:24

SSAP job SID0929647061042856 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 09:07

The entry "3ck1A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 09:07

The entry "3ck1A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:29

Retrieved PRC results for job ID SID3256316772604276 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 08:28

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 46 results for 3ck1A00

Flow stage update by auto on 04 Mar 2009 06:28

The entry "3ck1A00" has been submitted to the PRC webservice.

Prc cath submit by auto on 04 Mar 2009 06:28

The entry "3ck1A00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:37

Retrieved HMM(SAM) results for job ID SID1156913228056414 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:36

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 18 results for 3ck1A00

Update comment by auto on 04 Mar 2009 01:22

HMM(SAM) job SID1156913228056414 is not yet finished.

Flow stage update by auto on 03 Mar 2009 23:56

The entry "3ck1A00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Mar 2009 23:56

The entry "3ck1A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:13

Unable to retrieve "3ck1A00" HMM(SAM) results for job "SID3495883206974570"

Update comment by auto on 19 Feb 2009 08:45

HMM(SAM) job SID3495883206974570 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:21

The entry "3ck1A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:21

The entry "3ck1A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:26

Unable to retrieve "3ck1A00" HMM(SAM) results for job "SID0566927728320288"

Update comment by auto on 22 Jan 2009 17:55

HMM(SAM) job SID0566927728320288 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:40

The entry "3ck1A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:40

The entry "3ck1A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Dec 2008 04:14

Retrieved "3ck1A00" CATHEDRAL results for job ID SID1428545044119904 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Dec 2008 04:13

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 19 results for 3ck1A00

Update comment by auto on 03 Dec 2008 23:45

"3ck1A00" CATHEDRAL job SID1428545044119904 is not yet finished.

Cathedral cath submit by auto on 03 Dec 2008 23:40

The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 23:40

The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 20:55

Unable to retrieve "3ck1A00" CATHEDRAL results for job "SID0007910321814456"

Flow stage update by auto on 03 Dec 2008 20:47

The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Dec 2008 20:47

The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 17:51

Unable to retrieve "3ck1A00" CATHEDRAL results for job "SID8417835513699584"

Cathedral cath submit by auto on 03 Dec 2008 17:46

The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 17:46

The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 14:52

Unable to retrieve "3ck1A00" CATHEDRAL results for job "SID1510221996255516"

Cathedral cath submit by auto on 03 Dec 2008 14:38

The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 14:38

The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 10:43

Unable to retrieve "3ck1A00" CATHEDRAL results for job "SID5048006393034880"

Update comment by auto on 03 Dec 2008 01:05

"3ck1A00" CATHEDRAL job SID5048006393034880 is not yet finished.

Cathedral cath submit by auto on 03 Dec 2008 00:32

The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 00:32

The entry "3ck1A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 00:01

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3ck1A00.scanlist" for "3ck1A00"

Write scan list by auto on 03 Dec 2008 00:01

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3ck1A00.scanlist" for domain "3ck1A00"

Update comment by auto on 02 Dec 2008 21:06

Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.

Flow stage update by auto on 02 Dec 2008 20:25

No satisfactory AssignClose result found.

Flow stage update by auto on 02 Dec 2008 20:07

No in_process hits for Domain "3ck1A00" ready to be processed

Flow stage update by auto on 02 Dec 2008 20:07

NW result present for Domain "3ck1A00"

Flow stage update by auto on 02 Dec 2008 11:08

All required files are present for Domain "3ck1A00"

Flow stage update by auto on 01 Dec 2008 17:53

Beginning processing for Domain "3ck1A00"

Insertion by cuff on 01 Dec 2008 16:15

nice chopping