CATH Domain: 3cjeA00 XML data for domain: 3cjeA00

Molscript image for 3cjeA00
3cjeA00
PDB coordinates for domain 3cjeA00

PDB 3cje, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.300 GMP Synthetase; Chain A, domain 3
3.30.300.20 Gene3D
3.30.300.20.13
3.30.300.20.13.1
3.30.300.20.13.1.1
3.30.300.20.13.1.1.1
3.30.300.20.13.1.1.1.1

[top]
Segment boundaries for domain 3cjeA00

Chopping figure for domain 3cjeA00
DomainStart PDB ResidueStop PDB Residue
3cjeA00 11 166

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|3cjeA00
RAEVVFTCNGKAVGKRNELDVAVKPFEERFALATDEGASAPPPLALFIAGLTGCVTQIRAFAKRLKVTVTDLDVECRVVW
DWAKAGPVYETGPKSFEIDIILHSPDPIEAQQALIEAAKKGCFLEQTLGQANTIRHRLKVGDTFIDA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3cjeA00
GXALTPDQXPDRAEVVFTCNGKAVGKXRNELDVAXVKPFEERFALATDEGAFHGGDASAPPPLALFIAGLTGCVXTQIRA
FAKRLKVTVTDLDVECRVVWDWAKAGPVYETGPKSFEIDIILHSPDPIEAQQALIEAAKKGCFLEQTLGQANTIRHRLKV
GDTFIDA
BLAST against CATH

[top]
Domain History Events (58)

Domain assigned by cuff on 01 Apr 2009 11:23

homology match

Domain assignment manual match h by cuff on 01 Apr 2009 11:22

same superfamily

Homcheck allotment by cuff on 01 Apr 2009 11:20

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 01 Apr 2009 11:20

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 19:10

Domain "3cjeA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 19:09

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cjeA00

Flow stage update by auto on 19 Mar 2009 16:33

Retrieved PRC_PFAMCATH results for job ID SID2840119506732832 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 16:32

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 9 results for 3cjeA00

Update comment by auto on 08 Mar 2009 16:31

PRC_PFAMCATH job SID2840119506732832 is not yet finished.

Flow stage update by auto on 08 Mar 2009 16:13

The entry "3cjeA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 08 Mar 2009 16:13

The entry "3cjeA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Mar 2009 15:50

Retrieved SSAP results for job ID SID9494423234515616 and results inserted.

Domain scan ssap cath by auto on 08 Mar 2009 15:47

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1533 results for 3cjeA00

Update comment by auto on 04 Mar 2009 09:23

SSAP job SID9494423234515616 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 09:06

The entry "3cjeA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 09:06

The entry "3cjeA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:23

Retrieved PRC results for job ID SID8737088406621694 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 08:22

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 11 results for 3cjeA00

Prc cath submit by auto on 04 Mar 2009 06:27

The entry "3cjeA00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 06:27

The entry "3cjeA00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:31

Retrieved HMM(SAM) results for job ID SID0966805370091739 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:31

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 6 results for 3cjeA00

Update comment by auto on 04 Mar 2009 01:20

HMM(SAM) job SID0966805370091739 is not yet finished.

Sam cath submit by auto on 03 Mar 2009 23:55

The entry "3cjeA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:55

The entry "3cjeA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:12

Unable to retrieve "3cjeA00" HMM(SAM) results for job "SID4359116645841664"

Update comment by auto on 19 Feb 2009 08:44

HMM(SAM) job SID4359116645841664 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:19

The entry "3cjeA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:19

The entry "3cjeA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:26

Unable to retrieve "3cjeA00" HMM(SAM) results for job "SID0456422541892960"

Update comment by auto on 22 Jan 2009 17:54

HMM(SAM) job SID0456422541892960 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:39

The entry "3cjeA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:39

The entry "3cjeA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 15:10

Unable to retrieve "3cjeA00" HMM(SAM) results for job "SID5955568577014976"

Update comment by auto on 03 Dec 2008 11:10

HMM(SAM) job SID5955568577014976 is not yet finished.

Sam cath submit by auto on 03 Dec 2008 11:00

The entry "3cjeA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 11:00

The entry "3cjeA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:41

Retrieved "3cjeA00" CATHEDRAL results for job ID SID3963584883110120 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Dec 2008 10:40

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 312 results for 3cjeA00

Update comment by auto on 03 Dec 2008 01:04

"3cjeA00" CATHEDRAL job SID3963584883110120 is not yet finished.

Cathedral cath submit by auto on 03 Dec 2008 00:31

The entry "3cjeA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 00:31

The entry "3cjeA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 02 Dec 2008 23:59

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3cjeA00.scanlist" for "3cjeA00"

Write scan list by auto on 02 Dec 2008 23:59

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3cjeA00.scanlist" for domain "3cjeA00"

Update comment by auto on 02 Dec 2008 21:06

Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 17:28

Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 15:14

Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 11:26

Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 10:46

Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 23:28

Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 21:05

Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 18:10

Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Dec 2008 18:08

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Dec 2008 17:54

No in_process hits for Domain "3cjeA00" ready to be processed

Flow stage update by auto on 01 Dec 2008 17:54

NW result present for Domain "3cjeA00"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3cjeA00"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3cjeA00"

Insertion by cuff on 27 Nov 2008 18:01

nice chopping