CATH Domain: 3cj8A03

3cj8A03

PDB 3cj8, Chain A, Domain 3

CATH Code	Level Description	Links
2	Mainly Beta
2.160	3 Solenoid
2.160.10	UDP N-Acetylglucosamine Acyltransferase; domain 1
2.160.10.10	Hexapeptide repeat proteins	Gene3D
2.160.10.10.11
2.160.10.10.11.1
2.160.10.10.11.1.1
2.160.10.10.11.1.1.1
2.160.10.10.11.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 3cj8A03

Domain	Start PDB Residue	Stop PDB Residue
3cj8A01	0	13
3cj8A02	14	78
3cj8A03	79	218

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 2.160.10.10.11.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
3bfpA02	89.23	Campylobacter jejuniAcetyltransferase	2.160.10.10	116	25	82	4.04	4.92
1ssqD02	86.49	Sulfur metabolismCysteine and methionine metabolismMetabolic pathwaysHaemophilus influenzaeSerine acetyltransferase	2.160.10.10	119	25	76	1.82	2.39
1t3dA02	86.41	Sulfur metabolismMetabolic pathwaysCysteine and methionine metabolismSerine acetyltransferaseProtein binding	2.160.10.10	116	31	76	2.00	2.63
1ssqA02	85.95	Sulfur metabolismCysteine and methionine metabolismMetabolic pathwaysHaemophilus influenzaeSerine acetyltransferase	2.160.10.10	103	28	73	1.89	2.58
1m8nB00	83.01	Choristoneura fumiferanaAntifreeze protein isoform 501	2.160.10.20	119	5	76	2.94	3.86
1fxjA02	81.35	Amino sugar and nucleotide sugar metabolismMetabolic pathwaysGlucosamine-1-phosphate N-acetyltransferase activityUDP-N-acetylglucosamine biosynthetic processBifunctional protein GlmU [EC:2.7.7.23 2.3.1.157]	2.160.10.10	93	19	61	2.53	4.13

[top]
Domain ATOM Sequence

>pdb|3cj8A03
IPFLDLKDINARIEPGALIREKVEIGDQAVIGAILNIGAVVGAGTIDGAVLGGRATVGKHCHIGAGTVLAGVIEPPSAAP
VVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKVIKQIDD

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|3cj8A03
IPFLDLKDINARIEPGALIREKVEIGDQAVIXXGAILNIGAVVGAGTXIDXGAVLGGRATVGKHCHIGAGTVLAGVIEPP
SAAPVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKVIKQIDDKTKSKTEILEELRKL

BLAST against CATH

[top]
Domain History Events (58)

Domain assigned by cuff on 01 Apr 2009 11:13

superfamily match

Domain assignment manual match h by cuff on 01 Apr 2009 11:12

homology match

Homcheck allotment by cuff on 01 Apr 2009 11:10

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 01 Apr 2009 11:10

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 19:11

Domain "3cj8A03" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 19:10

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cj8A03

Flow stage update by auto on 19 Mar 2009 16:34

Retrieved PRC_PFAMCATH results for job ID SID7429886616532768 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 16:33

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 3cj8A03

Update comment by auto on 08 Mar 2009 16:31

PRC_PFAMCATH job SID7429886616532768 is not yet finished.

Flow stage update by auto on 08 Mar 2009 16:13

The entry "3cj8A03" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 08 Mar 2009 16:13

The entry "3cj8A03" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Mar 2009 15:50

Retrieved SSAP results for job ID SID8992070435785472 and results inserted.

Domain scan ssap cath by auto on 08 Mar 2009 15:50

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 47 results for 3cj8A03

Update comment by auto on 04 Mar 2009 09:23

SSAP job SID8992070435785472 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 09:06

The entry "3cj8A03" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 09:06

The entry "3cj8A03" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:24

Retrieved PRC results for job ID SID7927299204939276 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 08:23

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 17 results for 3cj8A03

Prc cath submit by auto on 04 Mar 2009 06:27

The entry "3cj8A03" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 06:27

The entry "3cj8A03" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:32

Retrieved HMM(SAM) results for job ID SID4535571647514398 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:32

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 17 results for 3cj8A03