CATH Domain: 3citA00

3citA00

PDB 3cit, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.30	2-Layer Sandwich
3.30.450	Beta-Lactamase
3.30.450.40		Gene3D
3.30.450.40.10
3.30.450.40.10.1
3.30.450.40.10.1.1
3.30.450.40.10.1.1.1
3.30.450.40.10.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 3citA00

Domain	Start PDB Residue	Stop PDB Residue
3citA00	16	172

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.450.40.10.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	3e0yA00	82.13	Conserved domain proteinGeobacter sulfurreducens	3.30.450.40	153	11	86	3.63	4.18
	1stzA02	78.33	Thermotoga maritimaHeat-inducible transcription repressor hrcAHeat-inducible transcriptional repressor	3.30.450.40	149	10	81	3.52	4.31

[top]
Domain ATOM Sequence

>pdb|3citA00
NAYRQSQSRAARLRLLVDTGQELIQLPPEARKCVLQRACAFVADHGLLLEWGNGVQTTARHGSKERLSTLETTADPLAIG
PQWLERPGTHLPCVLLLPLRGADEGSFGTLVLANSVAISAPDGEDIESLQLLATLLAAHLENNRLLEALVARD

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|3citA00
SNAYRQSQSRAARLRLLVDTGQELIQLPPEAXRKCVLQRACAFVAXDHGLLLEWGADNGVQTTARHGSKERLSTLETTAD
PLAIGPQWLERPGTHLPCVLLLPLRGADEGSFGTLVLANSVAISAPDGEDIESLQLLATLLAAHLENNRLLEALVARDRT

BLAST against CATH

[top]
Domain History Events (61)

Domain assigned by cuff on 01 Apr 2009 11:05

same homology

Domain assignment manual match h by cuff on 01 Apr 2009 11:04

same superfamily

Homcheck allotment by cuff on 01 Apr 2009 11:03

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 01 Apr 2009 11:03

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 19:08

Domain "3citA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 19:07

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3citA00

Flow stage update by auto on 19 Mar 2009 16:30

Retrieved PRC_PFAMCATH results for job ID SID4192423275207120 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 16:29

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 7 results for 3citA00

Update comment by auto on 08 Mar 2009 19:27

PRC_PFAMCATH job SID4192423275207120 is not yet finished.

Flow stage update by auto on 08 Mar 2009 19:10

The entry "3citA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 08 Mar 2009 19:09

The entry "3citA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Mar 2009 18:54

Retrieved SSAP results for job ID SID2372460259525936 and results inserted.

Domain scan ssap cath by auto on 08 Mar 2009 18:47

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2461 results for 3citA00

Update comment by auto on 04 Mar 2009 09:23

SSAP job SID2372460259525936 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 09:05

The entry "3citA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 09:05

The entry "3citA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:21

Retrieved PRC results for job ID SID3650905874525724 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 08:20

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 8 results for 3citA00

Flow stage update by auto on 04 Mar 2009 06:26

The entry "3citA00" has been submitted to the PRC webservice.

Prc cath submit by auto on 04 Mar 2009 06:26

The entry "3citA00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:30

Retrieved HMM(SAM) results for job ID SID7085121019727080 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:29

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 6 results for 3citA00

Update comment by auto on 04 Mar 2009 01:20

HMM(SAM) job SID7085121019727080 is not yet finished.

Flow stage update by auto on 03 Mar 2009 23:54

The entry "3citA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Mar 2009 23:54

The entry "3citA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:11

Unable to retrieve "3citA00" HMM(SAM) results for job "SID7947816347281504"

Update comment by auto on 19 Feb 2009 08:44

HMM(SAM) job SID7947816347281504 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:19

The entry "3citA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:19

The entry "3citA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:25

Unable to retrieve "3citA00" HMM(SAM) results for job "SID4021100947053392"

Update comment by auto on 22 Jan 2009 17:54

HMM(SAM) job SID4021100947053392 is not yet finished.

Flow stage update by auto on 22 Jan 2009 17:38

The entry "3citA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 22 Jan 2009 17:38

The entry "3citA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Dec 2008 03:59

Retrieved "3citA00" CATHEDRAL results for job ID SID4941521482416928 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Dec 2008 03:58

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 65 results for 3citA00