CATH Domain: 3ci6B00 XML data for domain: 3ci6B00

Molscript image for 3ci6B00
3ci6B00
PDB coordinates for domain 3ci6B00

PDB 3ci6, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.40 Gene3D
3.30.450.40.1
3.30.450.40.1.1
3.30.450.40.1.1.1
3.30.450.40.1.1.1.1
3.30.450.40.1.1.1.1.1

[top]
Segment boundaries for domain 3ci6B00

Chopping figure for domain 3ci6B00
DomainStart PDB ResidueStop PDB Residue
3ci6B00 2 168

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.30.450.40.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3e0yA00 86.65 Conserved domain proteinGeobacter sulfurreducens 3.30.450.40 153 24 92 3.75 4.06
3kshA00 85.52 GAF domain-containing proteinStaphylococcus aureus subsp. aureus MRSA252Putative uncharacterized protein 3.30.450.40 152 14 89 2.73 3.06
3eeaA00 84.04 GAF domain/HD domain proteinGeobacter sulfurreducens 3.30.450.40 153 14 88 4.01 4.52
3citA00 82.34 Pseudomonas syringae pv. tomatoSensor histidine kinase 3.30.450.40 153 11 85 3.56 4.16
1mc0A01 81.75 Mus musculusCGMP-dependent 3',5'-cyclic phosphodiesterase 3.30.450.40 158 15 90 3.16 3.49
2zmfB00 80.33 CAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10AHomo sapiens 3.30.450.40 167 15 89 4.32 4.81
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3ci6B00
SNQLDTLRRIVQEINSSVSLHDSLDIVNQVADAKVDVCSIYLLDERNQRYLLASKGLNPESVGHVSLQLSEGLVGLVGQR
EEIVNLENASKHERFAYLPGEEIYNSFLGVPVYRRKVGVLVVQNKQPQDFSEAAESFLVTLCAQLSGVIAHAHAVGNID
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3ci6B00
SNAXSNXQLDTLRRIVQEINSSVSLHDSLDIXVNQVADAXKVDVCSIYLLDERNQRYLLXASKGLNPESVGHVSLQLSEG
LVGLVGQREEIVNLENASKHERFAYLPETGEEIYNSFLGVPVXYRRKVXGVLVVQNKQPQDFSEAAESFLVTLCAQLSGV
IAHAHAVGNID
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 01 Apr 2009 11:37

Assigning to "3.30.450.40" based on similarity with "3ci6A00"

Flow stage update by auto on 01 Apr 2009 11:17

No in_process hits for Domain "3ci6B00" ready to be processed

Update comment by auto on 02 Dec 2008 17:10

Domain "3ci6B00" hits Domain "3ci6A00" (95.906432748538% over 100%) which is currently in process

Flow stage update by auto on 02 Dec 2008 17:08

Domain "3ci6B00" hits Domain "3ci6A00" (95.906432748538% over 100%) which is currently in process

Flow stage update by auto on 02 Dec 2008 17:08

NW result present for Domain "3ci6B00"

Flow stage update by auto on 02 Dec 2008 11:07

All required files are present for Domain "3ci6B00"

Flow stage update by auto on 01 Dec 2008 17:53

Beginning processing for Domain "3ci6B00"

Insertion by auto on 01 Dec 2008 17:16

Final ChopClose added based on similarity with "3ci6A"