CATH Domain: 3chvA00

3chvA00

PDB 3chv, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.20	Alpha-Beta Barrel
3.20.20	TIM Barrel
3.20.20.70	Aldolase class I	Gene3D
3.20.20.70.7
3.20.20.70.7.1
3.20.20.70.7.1.1
3.20.20.70.7.1.1.1
3.20.20.70.7.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 3chvA00

Domain	Start PDB Residue	Stop PDB Residue
3chvA00	5	283

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.20.20.70.7.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	3c6cA00	87.60	Ralstonia eutropha JMP134Putative uncharacterized protein	3.20.20.70	279	27	89	1.89	2.10
	3lb0A00	74.93	3-dehydroquinate dehydratase I [EC:4.2.1.10]Phenylalanine, tyrosine and tryptophan biosynthesisSalmonella enterica subsp. enterica serovar Typhimurium3-dehydroquinate dehydrataseMetabolic pathways	3.20.20.70	259	8	76	3.44	4.49

[top]
Domain ATOM Sequence

>pdb|3chvA00
ANKPCIICVAITGSVPTKADNPAVPITVSEQVESTQEAFEAGAAIAHCHVRNDDGTPSSDPDRFARLTEGLHTHCPGIVQ
FSTGGRSGAGQARGGLPLKPDASLSVGSNNFPSRVYENPPDLVDWLAAQRSYRVTPEIEAFDLSHILRAIDHGRGLLYGK
LYVQFVGVKNAPADREVFDFYVRRTRAPQAEWCAAGIGANQLTVNEWAIAAGGHTRTGLEDNIRLDRQTLAPSNAALVRR
SVELCDKYQRPVASWQQAREILGLPAAARN

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|3chvA00
GXDTPANKPCIICVAITGSVPTKADNPAVPITVSEQVESTQEAFEAGAAIAHCHVRNDDGTPSSDPDRFARLTEGLHTHC
PGXIVQFSTGGRSGAGQARGGXLPLKPDXASLSVGSNNFPSRVYENPPDLVDWLAAQXRSYRVTPEIEAFDLSHILRAID
XHGRGLLYGKLYVQFVXGVKNAXPADREVFDFYVRXXRTRAPQAEWCAAGIGANQLTVNEWAIAAGGHTRTGLEDNIRLD
RQTLAPSNAALVRRSVELCDKYQRPVASWQQAREILGLPAAARN

BLAST against CATH

[top]
Domain History Events (61)

Domain assigned by cuff on 01 Apr 2009 10:20

homology match

Domain assignment manual match h by cuff on 01 Apr 2009 10:18

same superfamily

Homcheck allotment by cuff on 01 Apr 2009 10:15

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 01 Apr 2009 10:15

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 19:05

Domain "3chvA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 19:04

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3chvA00

Flow stage update by auto on 19 Mar 2009 16:27

Retrieved PRC_PFAMCATH results for job ID SID1624142875277896 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 16:26

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 3 results for 3chvA00

Update comment by auto on 09 Mar 2009 13:42

PRC_PFAMCATH job SID1624142875277896 is not yet finished.

Prc pfamcath submit by auto on 09 Mar 2009 13:24

The entry "3chvA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 09 Mar 2009 13:24

The entry "3chvA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 09 Mar 2009 12:57

Retrieved SSAP results for job ID SID8325161338048192 and results inserted.

Domain scan ssap cath by auto on 09 Mar 2009 12:56

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 613 results for 3chvA00

Update comment by auto on 04 Mar 2009 09:23

SSAP job SID8325161338048192 is not yet finished.

Flow stage update by auto on 04 Mar 2009 09:05

The entry "3chvA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 04 Mar 2009 09:05

The entry "3chvA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:17

Retrieved PRC results for job ID SID1704862601869664 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 08:16

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 3chvA00

Prc cath submit by auto on 04 Mar 2009 06:25

The entry "3chvA00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 06:25

The entry "3chvA00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:27

Retrieved HMM(SAM) results for job ID SID2085876708275507 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:26

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 3chvA00

Update comment by auto on 04 Mar 2009 01:19

HMM(SAM) job SID2085876708275507 is not yet finished.

Flow stage update by auto on 03 Mar 2009 23:53

The entry "3chvA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Mar 2009 23:53

The entry "3chvA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:10

Unable to retrieve "3chvA00" HMM(SAM) results for job "SID9402702933531904"

Update comment by auto on 19 Feb 2009 08:44

HMM(SAM) job SID9402702933531904 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:19

The entry "3chvA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:19

The entry "3chvA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:25

Unable to retrieve "3chvA00" HMM(SAM) results for job "SID9123221201948832"

Update comment by auto on 22 Jan 2009 17:54

HMM(SAM) job SID9123221201948832 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:38

The entry "3chvA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:38

The entry "3chvA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Dec 2008 03:54

Retrieved "3chvA00" CATHEDRAL results for job ID SID3136866271129488 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Dec 2008 03:53

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 142 results for 3chvA00