CATH Domain: 3ch0A00

3ch0A00

PDB 3ch0, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.20	Alpha-Beta Barrel
3.20.20	TIM Barrel
3.20.20.190	Phosphatidylinositol (PI) phosphodiesterase	Gene3D
3.20.20.190.1
3.20.20.190.1.1
3.20.20.190.1.1.1
3.20.20.190.1.1.1.1
3.20.20.190.1.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 3ch0A00

Domain	Start PDB Residue	Stop PDB Residue
3ch0A00	0	271

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.20.20.190.1.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
2oogD00	86.58	Glycerophospholipid metabolismGlycerophosphoryl diester phosphodiesteraseStaphylococcus aureus subsp. aureus str. NewmanGlycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]	3.20.20.190	262	22	90	3.16	3.49
2o55A00	84.56		3.20.20.190	247	21	86	2.51	2.92
2otdA01	84.45	Glycerophospholipid metabolismShigella flexneriGlycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]Glycerophosphodiester phosphodiesterase	3.20.20.190	222	25	82	2.38	2.89
1o1zA00	84.40	Thermotoga maritimaGlycerophospholipid metabolismGlycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]Putative uncharacterized protein	3.20.20.190	226	26	81	2.27	2.78
1ydyA00	82.83	Glycerophospholipid metabolismGlycerophosphoryl diester phosphodiesteraseGlycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]Protein bindingEscherichia coli K-12	3.20.20.190	328	23	77	2.85	3.68

[top]
Domain ATOM Sequence

>pdb|3ch0A00
GIQVPASFDIQGHRGCRGLLPENTIAAFTKALLLGVTTLEFDLVISKDNRVVVSHDTFFHHEITVDGEDVTEANEKNFNL
YANYADIKEIDVGKTHPRFKSQKKVPAVKPLFRELIETAEKLSAKIQYNGEIKSTVEGDNIDHPNIALFCDLVVAEIKKA
HITDRFTLQSFDVRALEYHSQYPDIKLSYLVETKGTLKKQLEKLSFTPAVYSPDVTLVSKKDIDAAHKLGRVIPWTVNTK
EEIETLISLGVDGIITDYPDLFFEK

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|3ch0A00
GXIQVPASFDIQGHRGCRGLLPENTIAAFTKALLLGVTTLEFDLVISKDNRVVVSHDTFFHHEITXXVDGEDVTEANEKN
FNLYAXNYADIKEIDVGXKTHPRFKSQKKVPAVKPLFRELIETAEKLSAKIQYNGEIKSTVEGDNIDHPNIALFCDLVVA
EIKKAHITDRFTLQSFDVRALEYXHSQYPDIKLSYLVETKGTLKKQLEKLSFTPAVYSPDVTLVSKKDIDAAHKLGXRVI
PWTVNTKEEIETLISLGVDGIITDYPDLFFEK

BLAST against CATH

[top]
Domain History Events (58)

Domain assigned by cuff on 31 Mar 2009 12:43

superfamily match

Domain assignment manual match h by cuff on 31 Mar 2009 12:39

same superfamily

Homcheck allotment by cuff on 31 Mar 2009 12:34

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 31 Mar 2009 12:34

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 19:03

Domain "3ch0A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 19:02

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3ch0A00

Flow stage update by auto on 19 Mar 2009 16:24

Retrieved PRC_PFAMCATH results for job ID SID0813389435358336 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 16:23

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 21 results for 3ch0A00

Update comment by auto on 09 Mar 2009 13:42

PRC_PFAMCATH job SID0813389435358336 is not yet finished.

Flow stage update by auto on 09 Mar 2009 13:24

The entry "3ch0A00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 09 Mar 2009 13:24

The entry "3ch0A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 09 Mar 2009 12:56

Retrieved SSAP results for job ID SID9619906533161936 and results inserted.

Domain scan ssap cath by auto on 09 Mar 2009 12:53

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 532 results for 3ch0A00

Update comment by auto on 04 Mar 2009 09:22

SSAP job SID9619906533161936 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 09:05

The entry "3ch0A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 09:05

The entry "3ch0A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:16

Retrieved PRC results for job ID SID7669436261402486 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 08:15

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 10 results for 3ch0A00

Flow stage update by auto on 04 Mar 2009 06:25

The entry "3ch0A00" has been submitted to the PRC webservice.

Prc cath submit by auto on 04 Mar 2009 06:25

The entry "3ch0A00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:24

Retrieved HMM(SAM) results for job ID SID4609003974558453 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:24

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 9 results for 3ch0A00