Domain assigned by cuff on 15 Apr 2009 11:51
homology match
CATH Domain: 3cgvA02
3cgvA02
PDB 3cgv, Chain A, Domain 2
Segment boundaries for domain 3cgvA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3cgvA01 | 0 | 69 |
| 3cgvA01 | 86 | 174 |
| 3cgvA01 | 270 | 321 |
| 3cgvA01 | 322 | 349 |
| 3cgvA02 | 70 | 85 |
| 3cgvA02 | 175 | 269 |
| 3cgvA02 | 350 | 386 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|3cgvA02 KGARIYGPSEKRPIILARNDIISALQYRINVDVDPDYTDFYLGSIAPAGYIWVFPKGEGANVGIGSSINWIHNRFELKNY LDRFIENHPGLKKGQDIQLVTGGVSVSKVALSDDTLDKLVDIVSEQVLTTISVEAILKAIAEKYP
Domain History Events (76)
Domain assignment manual match h by cuff on 15 Apr 2009 11:50
same superfamily
Homcheck allotment by cuff on 31 Mar 2009 12:30
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 31 Mar 2009 12:30
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 15 Mar 2009 20:04
Domain "3cgvA02" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 15 Mar 2009 20:03
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cgvA02
Flow stage update by auto on 15 Mar 2009 19:05
Retrieved PRC_PFAMCATH results for job ID SID0370854487914624 and results inserted.
Domain scan prc pfamcath by auto on 15 Mar 2009 19:04
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 331 results for 3cgvA02
Update comment by auto on 10 Mar 2009 12:05
PRC_PFAMCATH job SID0370854487914624 is not yet finished.
Prc pfamcath submit by auto on 10 Mar 2009 12:04
The entry "3cgvA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 10 Mar 2009 12:04
The entry "3cgvA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 10 Mar 2009 11:52
Retrieved SSAP results for job ID SID3593381178880736 and results inserted.
Domain scan ssap cath by auto on 10 Mar 2009 11:50
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 955 results for 3cgvA02
Update comment by auto on 09 Mar 2009 22:01
SSAP job SID3593381178880736 is not yet finished.
Flow stage update by auto on 09 Mar 2009 21:45
The entry "3cgvA02" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 09 Mar 2009 21:45
The entry "3cgvA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Mar 2009 20:10
Retrieved PRC results for job ID SID1859338708593732 and inserted them into the database.
Domain scan prc cath by auto on 09 Mar 2009 20:10
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 10 results for 3cgvA02
Update comment by auto on 09 Mar 2009 12:37
PRC job SID1859338708593732 is not yet finished.
Prc cath submit by auto on 09 Mar 2009 12:08
The entry "3cgvA02" has been submitted to the PRC webservice.
Flow stage update by auto on 09 Mar 2009 12:08
The entry "3cgvA02" has been submitted to the PRC webservice.
Flow stage update by auto on 09 Mar 2009 10:38
Retrieved HMM(SAM) results for job ID SID7714913033410304 and inserted them into the database.
Domain scan sam cath by auto on 09 Mar 2009 10:37
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3cgvA02
Update comment by auto on 04 Mar 2009 12:42
HMM(SAM) job SID7714913033410304 is not yet finished.
Sam cath submit by auto on 04 Mar 2009 12:13
The entry "3cgvA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Mar 2009 12:13
The entry "3cgvA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Mar 2009 05:24
Unable to retrieve "3cgvA02" HMM(SAM) results for job "SID1765587922848649"
Update comment by auto on 04 Mar 2009 01:18
HMM(SAM) job SID1765587922848649 is not yet finished.
Sam cath submit by auto on 03 Mar 2009 23:52
The entry "3cgvA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Mar 2009 23:52
The entry "3cgvA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 16:10
Unable to retrieve "3cgvA02" HMM(SAM) results for job "SID8092443300035456"
Flow stage update by auto on 19 Feb 2009 15:24
The entry "3cgvA02" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 19 Feb 2009 15:24
The entry "3cgvA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 13:20
Retrieved "3cgvA02" CATHEDRAL results for job ID SID6388305466658496 and inserted them into the database.
Domain scan cathedral cath by auto on 19 Feb 2009 13:20
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 17 results for 3cgvA02
Update comment by auto on 19 Feb 2009 07:42
"3cgvA02" CATHEDRAL job SID6388305466658496 is not yet finished.
Cathedral cath submit by auto on 19 Feb 2009 06:26
The entry "3cgvA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 19 Feb 2009 06:26
The entry "3cgvA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 27 Jan 2009 12:03
Unable to retrieve "3cgvA02" CATHEDRAL results for job "SID7939380549316822"
Update comment by auto on 22 Jan 2009 17:12
"3cgvA02" CATHEDRAL job SID7939380549316822 is not yet finished.
Cathedral cath submit by auto on 22 Jan 2009 16:47
The entry "3cgvA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Jan 2009 16:47
The entry "3cgvA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 21 Dec 2008 15:06
ScanList with 12830 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3cgvA02.scanlist" for "3cgvA02"
Write scan list by auto on 21 Dec 2008 15:06
Writing ScanList containing 12830 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3cgvA02.scanlist" for domain "3cgvA02"
Update comment by auto on 21 Dec 2008 11:52
Waiting for 76 new domains (example : 3davB00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 20:42
Waiting for 113 new domains (example : 3bmkB00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 19:04
Waiting for 148 new domains (example : 3bllA00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 14:36
Waiting for 197 new domains (example : 2vmtA02) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 11:35
Waiting for 239 new domains (example : 2jknF00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 07:50
Waiting for 256 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 03:58
Waiting for 248 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 20 Dec 2008 00:50
Waiting for 246 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 19 Dec 2008 20:43
Waiting for 197 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 19 Dec 2008 16:56
Waiting for 189 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Update comment by auto on 19 Dec 2008 11:35
Waiting for 32 new domains (example : 2jknA00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 23:33
Waiting for 2 new domains (example : 3fcxA00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 22:12
Waiting for 27 new domains (example : 3ex7B00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 17:38
Waiting for 80 new domains (example : 2zecD01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 14:52
Waiting for 132 new domains (example : 2zebD01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 11:32
Waiting for 174 new domains (example : 2zebD01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 09:48
Waiting for 227 new domains (example : 2w42B01) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 04:25
Waiting for 270 new domains (example : 2rklB00) to be processed so that they can be scanned against too.
Update comment by auto on 17 Dec 2008 00:28
Waiting for 285 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 20:35
Waiting for 267 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 18:32
Waiting for 261 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 14:43
Waiting for 215 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 16 Dec 2008 10:54
Waiting for 201 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Dec 2008 20:40
Waiting for 150 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Update comment by auto on 15 Dec 2008 17:13
Waiting for 297 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Update comment by auto on 14 Dec 2008 20:41
Waiting for 337 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Flow stage update by auto on 14 Dec 2008 20:39
No satisfactory AssignClose result found.
Flow stage update by auto on 14 Dec 2008 20:15
No in_process hits for Domain "3cgvA02" ready to be processed
Flow stage update by auto on 14 Dec 2008 20:15
NW result present for Domain "3cgvA02"
Flow stage update by auto on 10 Dec 2008 14:16
All required files are present for Domain "3cgvA02"
Flow stage update by auto on 10 Dec 2008 14:14
Beginning processing for Domain "3cgvA02"
Insertion by cuff on 08 Dec 2008 13:14
nice chopping
