CATH Domain: 3cgvA01 XML data for domain: 3cgvA01

Molscript image for 3cgvA01
3cgvA01
PDB coordinates for domain 3cgvA01

PDB 3cgv, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.50 3-Layer(bba) Sandwich
3.50.50 FAD/NAD(P)-binding domain
3.50.50.60 Gene3D
3.50.50.60.72
3.50.50.60.72.1
3.50.50.60.72.1.1
3.50.50.60.72.1.1.1
3.50.50.60.72.1.1.1.1

[top]
Segment boundaries for domain 3cgvA01

Chopping figure for domain 3cgvA01
DomainStart PDB ResidueStop PDB Residue
3cgvA01 0 69
3cgvA01 86 174
3cgvA01 270 321
3cgvA01 322 349
3cgvA02 70 85
3cgvA02 175 269
3cgvA02 350 386

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|3cgvA01
GETYDVLVVGGGPGGSTAARYAAKYGLKTLIEKRPEIGSPVRCGEGLSKGILNEADIKADRSFIANEVQNEVGYVLERDK
FDKHLAALAAKAGADVWVKSPALGVIKENGKVAGAKIRHNNEIVDVRAKVIAADGFESEFGRWAGLKSVILKPITPGLLV
GDAARLIDPITGGGIANAIVSGYAAQVTKEAIESNDYSPQQKYEKLIKERFERKHLRNWVAKEKL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3cgvA01
GXETYDVLVVGGGPGGSTAARYAAKYGLKTLXIEKRPEIGSPVRCGEGLSKGILNEADIKADRSFIANEVQSEKAGNEVG
YVLERDKFDKHLAALAAKAGADVWVKSPALGVIKENGKVAGAKIRHNNEIVDVRAKXVIAADGFESEFGRWAGLKSVILK
XPITXPGLXLVGDAARLIDPITGGGIANAIVSGXYAAQVTKEAIESNDYSPQXXQKYEKLIKERFERKHLRNWVAKEKL
BLAST against CATH

[top]
Domain History Events (76)

Domain assigned by cuff on 15 Apr 2009 11:55

homology match

Domain assignment manual match h by cuff on 15 Apr 2009 11:54

same superfamily

Homcheck allotment by cuff on 31 Mar 2009 12:29

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 31 Mar 2009 12:29

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Mar 2009 20:05

Domain "3cgvA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Mar 2009 20:04

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cgvA01

Flow stage update by auto on 15 Mar 2009 19:06

Retrieved PRC_PFAMCATH results for job ID SID9717859644642192 and results inserted.

Domain scan prc pfamcath by auto on 15 Mar 2009 19:05

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 3844 results for 3cgvA01

Update comment by auto on 11 Mar 2009 00:46

PRC_PFAMCATH job SID9717859644642192 is not yet finished.

Flow stage update by auto on 11 Mar 2009 00:44

The entry "3cgvA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 11 Mar 2009 00:44

The entry "3cgvA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 11 Mar 2009 00:11

Retrieved SSAP results for job ID SID1475636031467008 and results inserted.

Domain scan ssap cath by auto on 11 Mar 2009 00:06

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 966 results for 3cgvA01

Update comment by auto on 09 Mar 2009 22:01

SSAP job SID1475636031467008 is not yet finished.

Ssap cath submit by auto on 09 Mar 2009 21:45

The entry "3cgvA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Mar 2009 21:45

The entry "3cgvA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Mar 2009 20:11

Retrieved PRC results for job ID SID1398022493916902 and inserted them into the database.

Domain scan prc cath by auto on 09 Mar 2009 20:11

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 117 results for 3cgvA01

Update comment by auto on 09 Mar 2009 12:37

PRC job SID1398022493916902 is not yet finished.

Prc cath submit by auto on 09 Mar 2009 12:08

The entry "3cgvA01" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Mar 2009 12:08

The entry "3cgvA01" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Mar 2009 10:39

Retrieved HMM(SAM) results for job ID SID7424600444205720 and inserted them into the database.

Domain scan sam cath by auto on 09 Mar 2009 10:38

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 62 results for 3cgvA01

Update comment by auto on 04 Mar 2009 12:42

HMM(SAM) job SID7424600444205720 is not yet finished.

Flow stage update by auto on 04 Mar 2009 12:13

The entry "3cgvA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Mar 2009 12:13

The entry "3cgvA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 05:25

Unable to retrieve "3cgvA01" HMM(SAM) results for job "SID1757334802238252"

Update comment by auto on 04 Mar 2009 01:18

HMM(SAM) job SID1757334802238252 is not yet finished.

Sam cath submit by auto on 03 Mar 2009 23:52

The entry "3cgvA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:52

The entry "3cgvA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:10

Unable to retrieve "3cgvA01" HMM(SAM) results for job "SID5012058949696704"

Sam cath submit by auto on 19 Feb 2009 15:24

The entry "3cgvA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 15:24

The entry "3cgvA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 13:22

Retrieved "3cgvA01" CATHEDRAL results for job ID SID4360715300559856 and inserted them into the database.

Domain scan cathedral cath by auto on 19 Feb 2009 13:21

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 476 results for 3cgvA01

Update comment by auto on 19 Feb 2009 07:42

"3cgvA01" CATHEDRAL job SID4360715300559856 is not yet finished.

Cathedral cath submit by auto on 19 Feb 2009 06:27

The entry "3cgvA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 19 Feb 2009 06:27

The entry "3cgvA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 27 Jan 2009 12:03

Unable to retrieve "3cgvA01" CATHEDRAL results for job "SID4803153615738832"

Update comment by auto on 22 Jan 2009 17:12

"3cgvA01" CATHEDRAL job SID4803153615738832 is not yet finished.

Cathedral cath submit by auto on 22 Jan 2009 16:47

The entry "3cgvA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Jan 2009 16:47

The entry "3cgvA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 21 Dec 2008 15:06

ScanList with 12830 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3cgvA01.scanlist" for "3cgvA01"

Write scan list by auto on 21 Dec 2008 15:06

Writing ScanList containing 12830 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3cgvA01.scanlist" for domain "3cgvA01"

Update comment by auto on 21 Dec 2008 11:52

Waiting for 76 new domains (example : 3davB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 20:42

Waiting for 113 new domains (example : 3bmkB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 19:04

Waiting for 148 new domains (example : 3bllA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 14:36

Waiting for 197 new domains (example : 2vmtA02) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 11:35

Waiting for 239 new domains (example : 2jknF00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 07:50

Waiting for 256 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 03:58

Waiting for 248 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 00:50

Waiting for 246 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 20:43

Waiting for 197 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 16:56

Waiting for 189 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 11:35

Waiting for 32 new domains (example : 2jknA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 23:33

Waiting for 2 new domains (example : 3fcxA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 22:12

Waiting for 27 new domains (example : 3ex7B00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 17:38

Waiting for 80 new domains (example : 2zecD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 14:52

Waiting for 132 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 11:32

Waiting for 174 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 09:48

Waiting for 227 new domains (example : 2w42B01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 04:25

Waiting for 270 new domains (example : 2rklB00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 00:28

Waiting for 285 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 20:35

Waiting for 267 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 18:32

Waiting for 261 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 14:43

Waiting for 215 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 10:54

Waiting for 201 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Dec 2008 20:40

Waiting for 150 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Dec 2008 17:13

Waiting for 297 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Dec 2008 20:41

Waiting for 337 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Flow stage update by auto on 14 Dec 2008 20:39

No satisfactory AssignClose result found.

Flow stage update by auto on 14 Dec 2008 20:15

No in_process hits for Domain "3cgvA01" ready to be processed

Flow stage update by auto on 14 Dec 2008 20:15

NW result present for Domain "3cgvA01"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "3cgvA01"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "3cgvA01"

Insertion by cuff on 08 Dec 2008 13:14

nice chopping