CATH Domain: 3cetB02 XML data for domain: 3cetB02

Molscript image for 3cetB02
3cetB02
PDB coordinates for domain 3cetB02

PDB 3cet, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.190 conserved archaeal protein q6m145 Gene3D
3.30.420.190.1
3.30.420.190.1.1
3.30.420.190.1.1.1
3.30.420.190.1.1.1.1
3.30.420.190.1.1.1.1.1

[top]
Segment boundaries for domain 3cetB02

Chopping figure for domain 3cetB02
DomainStart PDB ResidueStop PDB Residue
3cetB01 2 111
3cetB02 112 330

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|3cetB02
SNWCGTAKWVSKNIEENCILVDGSTTTDIIPIVEGKVVAEKTDLERLNHELLYVGTLRTPISHLGNTISFKGVDTNVSSE
YFAITADISVVLEKVTTEEYTCDTPDGKGTDKRSSLVRISKVLCSDLDQISEIDAENIAKNYYELWKELILENVENVAEK
YGSKKVVITGLGENILKDALADFEVISVAERYGKDVSLATPSFAVAELLKNELLEHH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3cetB02
SNWCGTAKWVSKNIEENCILVDXGSTTTDIIPIVEGKVVAEKTDLERLXNHELLYVGTLRTPISHLGNTISFKGVDTNVS
SEYFAITADISVVLEKVTTEEYTCDTPDGKGTDKRSSLVRISKVLCSDLDQISEIDAENIAKNYYELWKELILENVENVA
EKYGSKKVVITGLGENILKDALADFEVISVAERYGKDVSLATPSFAVAELLKNELLEHHHHHH
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 05 May 2009 17:46

Assigning to "3.30.420.190" based on similarity with "3c0bA02"

Flow stage update by auto on 05 May 2009 17:44

No in_process hits for Domain "3cetB02" ready to be processed

Update comment by auto on 05 May 2009 17:42

Domain "3cetB02" hits Domain "3cetA02" (99.1031390134529% over 100%) which is currently in process

Update comment by auto on 05 May 2009 17:39

Domain "3cetB02" hits Domain "3c0bB02" (99.1031390134529% over 100%) which is currently in process

Update comment by auto on 05 May 2009 17:32

Domain "3cetB02" hits Domain "3c0bC02" (99.1031390134529% over 100%) which is currently in process

Update comment by auto on 05 May 2009 17:11

Domain "3cetB02" hits Domain "3c0bD02" (99.1031390134529% over 100%) which is currently in process

Update comment by auto on 14 Dec 2008 20:19

Domain "3cetB02" hits Domain "3c0bA02" (99.1031390134529% over 100%) which is currently in process

Flow stage update by auto on 14 Dec 2008 20:15

Domain "3cetB02" hits Domain "3c0bA02" (99.1031390134529% over 100%) which is currently in process

Flow stage update by auto on 14 Dec 2008 20:15

NW result present for Domain "3cetB02"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "3cetB02"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "3cetB02"

Insertion by auto on 08 Dec 2008 12:08

Final ChopClose added based on similarity with "3c0bA"