CATH Domain: 3cetB01 XML data for domain: 3cetB01

Molscript image for 3cetB01
3cetB01
PDB coordinates for domain 3cetB01

PDB 3cet, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.20
3.30.420.40.20.1
3.30.420.40.20.1.1
3.30.420.40.20.1.1.1
3.30.420.40.20.1.1.1.1

[top]
Segment boundaries for domain 3cetB01

Chopping figure for domain 3cetB01
DomainStart PDB ResidueStop PDB Residue
3cetB01 2 111
3cetB02 112 330

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.420.40.20.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jcfA02 77.84 Thermotoga maritimaRod shape-determining protein MreB and related proteinsRod shape-determining protein MreB 3.30.420.40 89 11 69 3.32 4.78
1e4fT04 75.15 Thermotoga maritimaCell division protein FtsA, putativeCell division protein FtsA 3.30.420.40 89 11 67 3.26 4.82
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3cetB01
ILGIDIGGANTKITELHENGEFKVHHLYFPWKNNDKLAEVLKTYSNDVSHVALVTTAELADSYETKKEGVDNILNAAESA
FGSNISVFDSNGNFISLESAKTNNKVSA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3cetB01
XILGIDIGGANTKITELHENGEFKVHHLYFPXWKNNDKLAEVLKTYSNDVSHVALVTTAELADSYETKKEGVDNILNAAE
SAFGSNISVFDSNGNFISLESAKTNNXKVSA
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 26 Mar 2009 13:59

Assigning to "3.30.420.40" based on similarity with "3c0bA01"

Flow stage update by auto on 26 Mar 2009 13:39

No in_process hits for Domain "3cetB01" ready to be processed

Update comment by auto on 26 Mar 2009 13:15

Domain "3cetB01" hits Domain "3cetA01" (97.2972972972973% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 12:50

Domain "3cetB01" hits Domain "3c0bD01" (97.2972972972973% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 12:22

Domain "3cetB01" hits Domain "3c0bC01" (97.2972972972973% over 100%) which is currently in process

Update comment by auto on 26 Mar 2009 11:56

Domain "3cetB01" hits Domain "3c0bB01" (97.2972972972973% over 100%) which is currently in process

Update comment by auto on 14 Dec 2008 20:19

Domain "3cetB01" hits Domain "3c0bA01" (97.2972972972973% over 100%) which is currently in process

Flow stage update by auto on 14 Dec 2008 20:15

Domain "3cetB01" hits Domain "3c0bA01" (97.2972972972973% over 100%) which is currently in process

Flow stage update by auto on 14 Dec 2008 20:15

NW result present for Domain "3cetB01"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "3cetB01"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "3cetB01"

Insertion by auto on 08 Dec 2008 12:08

Final ChopClose added based on similarity with "3c0bA"