CATH Domain: 3cerC01 XML data for domain: 3cerC01

Molscript image for 3cerC01
3cerC01
PDB coordinates for domain 3cerC01

PDB 3cer, Chain C, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.24
3.30.420.40.24.1
3.30.420.40.24.1.1
3.30.420.40.24.1.1.1
3.30.420.40.24.1.1.1.1

[top]
Segment boundaries for domain 3cerC01

Chopping figure for domain 3cerC01
DomainStart PDB ResidueStop PDB Residue
3cerC01 12 139
3cerC02 140 343

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.420.40.24.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3h1qA02 78.57 Ethanolamine utilization protein EutJCarboxydothermus hydrogenoformans Z-2901Ethanolamine utilization protein EutJ 3.30.420.40 113 12 72 3.48 4.80
1huxA01 77.45 Activator of (R)-2-hydroxyglutaryl-CoA dehydrataseAcidaminococcus fermentans DSM 20731 3.30.420.40 119 13 69 3.37 4.86
3bzcA03 76.46 Pseudomonas aeruginosaPutative uncharacterized protein 3.30.420.140 128 9 78 3.94 4.99
1jcfA02 74.64 Thermotoga maritimaRod shape-determining protein MreB and related proteinsRod shape-determining protein MreB 3.30.420.40 89 7 63 3.08 4.83
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3cerC01
SKESVTVAGIDCGTNSIRLKIARVDADGHEVVPRILRVIRLGQDVDKTHRFADEALERAYVAAREFAGVIAEHPIDGLRF
VATSATRDAENREEFEDEIERILGVRPEVIPGTEEADLSFLGATSVV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3cerC01
XGHHHHHHSHXSKESVTVAGIDCGTNSIRLKIARVDADGXHEVVPRILRVIRLGQDVDKTHRFADEALERAYVAAREFAG
VIAEHPIDGLRFVATSATRDAENREEFEDEIERILGVRPEVIPGTEEADLSFLGATSVV
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 31 Mar 2009 11:55

Assigning to "3.30.420.40" based on similarity with "3cerA01"

Flow stage update by auto on 31 Mar 2009 11:52

No in_process hits for Domain "3cerC01" ready to be processed

Update comment by auto on 31 Mar 2009 11:50

Domain "3cerC01" hits Domain "3cerD01" (97.841726618705% over 100%) which is currently in process

Update comment by auto on 31 Mar 2009 11:45

Domain "3cerC01" hits Domain "3cerE01" (97.841726618705% over 100%) which is currently in process

Update comment by auto on 31 Mar 2009 11:33

Domain "3cerC01" hits Domain "3cerB01" (97.841726618705% over 100%) which is currently in process

Update comment by auto on 01 Dec 2008 14:12

Domain "3cerC01" hits Domain "3cerA01" (97.841726618705% over 100%) which is currently in process

Flow stage update by auto on 01 Dec 2008 14:09

Domain "3cerC01" hits Domain "3cerA01" (97.841726618705% over 100%) which is currently in process

Flow stage update by auto on 01 Dec 2008 14:09

NW result present for Domain "3cerC01"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3cerC01"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3cerC01"

Insertion by auto on 27 Nov 2008 18:49

Final ChopClose added based on similarity with "3cerA"