CATH Domain: 3cedA00 XML data for domain: 3cedA00

Molscript image for 3cedA00
3cedA00
PDB coordinates for domain 3cedA00

PDB 3ced, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.70 Alpha-Beta Plaits
3.30.70.260 Gene3D
3.30.70.260.15
3.30.70.260.15.1
3.30.70.260.15.1.1
3.30.70.260.15.1.1.1
3.30.70.260.15.1.1.1.1

[top]
Segment boundaries for domain 3cedA00

Chopping figure for domain 3cedA00
DomainStart PDB ResidueStop PDB Residue
3cedA00 244 341

Structural Neighbourhood (17 entries)

There are 17 matching structural neighberhood comparisons for CATH ID 3.30.70.260.15.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 17 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1nsaA01 81.13 Sus scrofaCarboxypeptidase B [EC:3.4.17.2]Carboxypeptidase B 3.30.70.340 92 11 72 2.79 3.87
1pytA00 80.81 Bos taurusCarboxypeptidase A1 [EC:3.4.17.1]Carboxypeptidase A1 3.30.70.340 94 6 77 3.49 4.51
1ayeA01 80.66 Carboxypeptidase A2 [EC:3.4.17.15]Homo sapiensMetallocarboxypeptidase activityVacuolar protein catabolic processCarboxypeptidase A2 3.30.70.340 99 5 75 3.71 4.90
2x3dF01 79.93 Hypothetical proteinSulfolobus solfataricusPutative uncharacterized protein 3.30.70.1340 84 10 78 3.04 3.88
1jqgA01 79.56 Carboxypeptidase AHelicoverpa armigera 3.30.70.340 91 6 74 3.11 4.19
2nzcA00 78.96 Thermotoga maritimaPutative uncharacterized protein 3.30.70.1150 77 11 77 3.36 4.35
1harA02 77.95 Human immunodeficiency virus type 1 BH10Gag-Pol polyprotein 3.30.70.270 69 11 63 3.08 4.82
1u0sA00 76.81 Thermotoga maritimaBacterial chemotaxisTwo-component systemTwo-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]Protein binding 3.30.70.1110 86 9 76 3.80 4.98
2v8hA02 76.30 Beta-alanine synthaseLachancea kluyveri 3.30.70.360 116 8 68 3.32 4.81
1ptfA00 76.04 Phosphocarrier protein HPrPhosphocarrier proteinEnterococcus faecalis 3.30.1340.10 87 5 65 2.76 4.18
2iboA00 75.19 Streptococcus pneumoniaePutative uncharacterized protein 3.30.70.930 87 2 67 3.16 4.72
1s99A02 75.00 Bacillus subtilisPutative HMP/thiamine-binding protein ykoF 3.30.70.930 81 4 69 3.24 4.69
1uv7A00 74.37 Vibrio choleraeGeneral secretion pathway protein M 3.30.1360.100 74 5 58 2.33 3.97
1f0xA04 74.07 Pyruvate metabolismD-lactate dehydrogenaseNAD or NADH bindingEscherichia coli K-12D-lactate dehydrogenase [EC:1.1.1.28] 3.30.1370.20 85 5 76 3.51 4.60
1mw7A03 73.64 Helicobacter pyloriUPF0082 protein HP_0162 3.30.70.980 75 5 69 3.33 4.82
1kn6A00 72.43 Mus musculusPeptide hormone processingSerine-type endopeptidase activityNeuroendocrine convertase 1Proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93] 3.30.70.850 73 2 65 3.06 4.64
1sqgA03 71.89 Ribosomal RNA small subunit methyltransferase B [EC:2.1.1.-]Ribosomal RNA small subunit methyltransferase BRRNA (cytosine-C5-)-methyltransferase activityRRNA base methylationEscherichia coli K-12 3.30.70.1170 58 10 59 2.83 4.73
[1]
Displaying entries 1 to 17 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3cedA00
SNADDFETSLTELEPLEKDAYIVRLVFAGSTTTEPIVSSLSTAYDIKINILEANIKNTKNGTVGFLVLHIPYISSVDFGK
FEKELIERQVKEVLRHG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3cedA00
SNADDFETSLTELEPLEKDAYIVRLVFAGSTTTEPIVSSLSTAYDIKINILEANIKNTKNGTVGFLVLHIPYISSVDFGK
FEKELIERQVKXEVLRHG
BLAST against CATH

[top]
Domain History Events (59)

Domain assigned by cuff on 31 Mar 2009 11:22

homology match

Domain assignment manual match h by cuff on 31 Mar 2009 11:22

same superfamily

Homcheck allotment by cuff on 31 Mar 2009 11:20

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 31 Mar 2009 11:20

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 18:51

Domain "3cedA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 18:50

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cedA00

Flow stage update by auto on 19 Mar 2009 16:08

Retrieved PRC_PFAMCATH results for job ID SID6474190301664544 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 16:07

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 3cedA00

Update comment by auto on 07 Mar 2009 19:13

PRC_PFAMCATH job SID6474190301664544 is not yet finished.

Prc pfamcath submit by auto on 07 Mar 2009 18:59

The entry "3cedA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Mar 2009 18:59

The entry "3cedA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Mar 2009 18:47

Retrieved SSAP results for job ID SID7260351241496576 and results inserted.

Domain scan ssap cath by auto on 07 Mar 2009 18:39

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 4345 results for 3cedA00

Update comment by auto on 04 Mar 2009 09:21

SSAP job SID7260351241496576 is not yet finished.

Flow stage update by auto on 04 Mar 2009 09:03

The entry "3cedA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 04 Mar 2009 09:03

The entry "3cedA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:05

Retrieved PRC results for job ID SID7108410043523160 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 08:04

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 3 results for 3cedA00

Prc cath submit by auto on 04 Mar 2009 06:21

The entry "3cedA00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 06:21

The entry "3cedA00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:13

Retrieved HMM(SAM) results for job ID SID6043139711686720 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:13

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 3cedA00

Update comment by auto on 04 Mar 2009 01:16

HMM(SAM) job SID6043139711686720 is not yet finished.

Sam cath submit by auto on 03 Mar 2009 23:49

The entry "3cedA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:49

The entry "3cedA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:08

Unable to retrieve "3cedA00" HMM(SAM) results for job "SID4460524426717440"

Update comment by auto on 19 Feb 2009 08:42

HMM(SAM) job SID4460524426717440 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:16

The entry "3cedA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:16

The entry "3cedA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:24

Unable to retrieve "3cedA00" HMM(SAM) results for job "SID2024780192807792"

Update comment by auto on 22 Jan 2009 17:52

HMM(SAM) job SID2024780192807792 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:36

The entry "3cedA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:36

The entry "3cedA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 15:09

Unable to retrieve "3cedA00" HMM(SAM) results for job "SID9152716886383840"

Update comment by auto on 03 Dec 2008 11:09

HMM(SAM) job SID9152716886383840 is not yet finished.

Sam cath submit by auto on 03 Dec 2008 10:58

The entry "3cedA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:58

The entry "3cedA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:20

Retrieved "3cedA00" CATHEDRAL results for job ID SID8545991044203688 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Dec 2008 10:18

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 202 results for 3cedA00

Update comment by auto on 03 Dec 2008 01:01

"3cedA00" CATHEDRAL job SID8545991044203688 is not yet finished.

Cathedral cath submit by auto on 03 Dec 2008 00:27

The entry "3cedA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 00:27

The entry "3cedA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 02 Dec 2008 23:53

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3cedA00.scanlist" for "3cedA00"

Write scan list by auto on 02 Dec 2008 23:53

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3cedA00.scanlist" for domain "3cedA00"

Update comment by auto on 02 Dec 2008 21:06

Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 17:28

Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 15:14

Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 11:26

Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 10:46

Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 23:28

Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 21:05

Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 18:09

Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 14:31

Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Dec 2008 14:30

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Dec 2008 14:09

No in_process hits for Domain "3cedA00" ready to be processed

Flow stage update by auto on 01 Dec 2008 14:09

NW result present for Domain "3cedA00"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3cedA00"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3cedA00"

Insertion by cuff on 27 Nov 2008 17:22

nice chopping