CATH Domain: 3ceaC02 XML data for domain: 3ceaC02

Molscript image for 3ceaC02
3ceaC02
PDB coordinates for domain 3ceaC02

PDB 3cea, Chain C, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.360 Dihydrodipicolinate Reductase; domain 2
3.30.360.10 Dihydrodipicolinate Reductase; domain 2 Gene3D
3.30.360.10.16
3.30.360.10.16.1
3.30.360.10.16.1.1
3.30.360.10.16.1.1.1
3.30.360.10.16.1.1.1.1

[top]
Segment boundaries for domain 3ceaC02

Chopping figure for domain 3ceaC02
DomainStart PDB ResidueStop PDB Residue
3ceaC01 6 129
3ceaC01 294 316
3ceaC02 131 293
3ceaC02 317 344

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.360.10.16.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ec7A02 75.56 Streptomycin biosynthesisMetabolic pathwaysInositol phosphate metabolismSalmonella enterica subsp. enterica serovar TyphimuriumInositol 2-dehydrogenase 3.30.360.10 118 10 62 2.50 4.02
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3ceaC02
RRYDDSYRYAKKIVDNGDIGKIIYRGYGIDPISGESFTKFATEADSGGIFVDNIHDIDLIRWFTGQDPVQAYGLTSNIAA
PQLADIGEFETGVAQLKSDGVIATLIGGRHAAHGNQVELEVGSNGWVRIGEHPDLNRVTVFNDQGVVRPSLQSFGERFTV
DDGIKALKIAKACQQSANIGKLVDIQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3ceaC02
RRYDDSYRYAKKIVDNGDIGKIIYXRGYGIDPISGXESFTKFATEADSGGIFVDXNIHDIDLIRWFTGQDPVQAYGLTSN
IAAPQLADIGEFETGVAQLKXSDGVIATLIGGRHAAHGNQVELEVXGSNGWVRIGEHPDLNRVTVFNDQGVVRPSLQSFG
ERFTVDDGIKALKIAKACQQSANIGKLVDIQL
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 31 Mar 2009 11:43

Assigning to "3.30.360.10" based on similarity with "3ceaD02"

Flow stage update by auto on 31 Mar 2009 11:33

No in_process hits for Domain "3ceaC02" ready to be processed

Update comment by auto on 31 Mar 2009 11:13

Domain "3ceaC02" hits Domain "3ceaD02" (97.3958333333333% over 100%) which is currently in process

Update comment by auto on 01 Dec 2008 14:12

Domain "3ceaC02" hits Domain "3ceaA02" (97.3958333333333% over 100%) which is currently in process

Flow stage update by auto on 01 Dec 2008 14:09

Domain "3ceaC02" hits Domain "3ceaA02" (97.3958333333333% over 100%) which is currently in process

Flow stage update by auto on 01 Dec 2008 14:09

NW result present for Domain "3ceaC02"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3ceaC02"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3ceaC02"

Insertion by auto on 27 Nov 2008 17:43

Final ChopClose added based on similarity with "3ceaA"