Domain assigned by cuff on 31 Mar 2009 11:05
same superfamily
CATH Domain: 3ce9A02
3ce9A02
PDB 3ce9, Chain A, Domain 2
Segment boundaries for domain 3ce9A02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3ce9A01 | 5 | 159 |
| 3ce9A02 | 160 | 353 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|3ce9A02 SPEKFIYSGIGDLVSNITALYDWKFEEENHKSIIDDFAVISKKSVNSFVRTDFKSIKDEVFLKELVDSLTNGIAEIAGNS SPASGAEHLISHALDKFLPNPQLHGIQVGVATYISKVHKHREERIKKILSDTGFFNYVKGLNKKSDFKRAISEAHLIKPA RYTYLHVEKNCETAKEIVDTDEILRNILV
Domain History Events (59)
Domain assignment manual match h by cuff on 31 Mar 2009 11:05
same superfamily
Homcheck allotment by cuff on 31 Mar 2009 11:01
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 31 Mar 2009 11:01
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 19 Mar 2009 18:52
Domain "3ce9A02" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 19 Mar 2009 18:51
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3ce9A02
Flow stage update by auto on 19 Mar 2009 16:09
Retrieved PRC_PFAMCATH results for job ID SID1968579293085240 and results inserted.
Domain scan prc pfamcath by auto on 19 Mar 2009 16:09
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 10 results for 3ce9A02
Update comment by auto on 08 Mar 2009 16:29
PRC_PFAMCATH job SID1968579293085240 is not yet finished.
Prc pfamcath submit by auto on 08 Mar 2009 16:12
The entry "3ce9A02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 08 Mar 2009 16:12
The entry "3ce9A02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 08 Mar 2009 15:36
Retrieved SSAP results for job ID SID6335049540428782 and results inserted.
Domain scan ssap cath by auto on 08 Mar 2009 15:34
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 448 results for 3ce9A02
Update comment by auto on 04 Mar 2009 09:21
SSAP job SID6335049540428782 is not yet finished.
Ssap cath submit by auto on 04 Mar 2009 09:03
The entry "3ce9A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 04 Mar 2009 09:03
The entry "3ce9A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 04 Mar 2009 08:07
Retrieved PRC results for job ID SID1711688560731042 and inserted them into the database.
Domain scan prc cath by auto on 04 Mar 2009 08:06
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 4 results for 3ce9A02
Prc cath submit by auto on 04 Mar 2009 06:22
The entry "3ce9A02" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Mar 2009 06:22
The entry "3ce9A02" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Mar 2009 05:15
Retrieved HMM(SAM) results for job ID SID5956983134278048 and inserted them into the database.
Domain scan sam cath by auto on 04 Mar 2009 05:15
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 3ce9A02
Update comment by auto on 04 Mar 2009 01:16
HMM(SAM) job SID5956983134278048 is not yet finished.
Flow stage update by auto on 03 Mar 2009 23:50
The entry "3ce9A02" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 03 Mar 2009 23:50
The entry "3ce9A02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 16:08
Unable to retrieve "3ce9A02" HMM(SAM) results for job "SID4282459853341232"
Update comment by auto on 19 Feb 2009 08:43
HMM(SAM) job SID4282459853341232 is not yet finished.
Sam cath submit by auto on 19 Feb 2009 08:17
The entry "3ce9A02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 08:17
The entry "3ce9A02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 27 Jan 2009 12:24
Unable to retrieve "3ce9A02" HMM(SAM) results for job "SID0647311952712416"
Update comment by auto on 22 Jan 2009 17:52
HMM(SAM) job SID0647311952712416 is not yet finished.
Sam cath submit by auto on 22 Jan 2009 17:36
The entry "3ce9A02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 22 Jan 2009 17:36
The entry "3ce9A02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Dec 2008 15:09
Unable to retrieve "3ce9A02" HMM(SAM) results for job "SID9226100336704272"
Update comment by auto on 03 Dec 2008 11:09
HMM(SAM) job SID9226100336704272 is not yet finished.
Sam cath submit by auto on 03 Dec 2008 10:59
The entry "3ce9A02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Dec 2008 10:59
The entry "3ce9A02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Dec 2008 10:23
Retrieved "3ce9A02" CATHEDRAL results for job ID SID8974024987633592 and inserted them into the database.
Domain scan cathedral cath by auto on 03 Dec 2008 10:22
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 159 results for 3ce9A02
Update comment by auto on 03 Dec 2008 01:02
"3ce9A02" CATHEDRAL job SID8974024987633592 is not yet finished.
Cathedral cath submit by auto on 03 Dec 2008 00:27
The entry "3ce9A02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Dec 2008 00:27
The entry "3ce9A02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 02 Dec 2008 23:54
ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3ce9A02.scanlist" for "3ce9A02"
Write scan list by auto on 02 Dec 2008 23:54
Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3ce9A02.scanlist" for domain "3ce9A02"
Update comment by auto on 02 Dec 2008 21:06
Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 17:28
Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 15:14
Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 11:26
Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 10:46
Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 23:28
Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 21:05
Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 18:09
Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2008 14:31
Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.
Flow stage update by auto on 01 Dec 2008 14:30
No satisfactory AssignClose result found.
Flow stage update by auto on 01 Dec 2008 14:09
No in_process hits for Domain "3ce9A02" ready to be processed
Flow stage update by auto on 01 Dec 2008 14:09
NW result present for Domain "3ce9A02"
Flow stage update by auto on 28 Nov 2008 11:14
All required files are present for Domain "3ce9A02"
Flow stage update by auto on 27 Nov 2008 20:08
Beginning processing for Domain "3ce9A02"
Insertion by cuff on 27 Nov 2008 16:55
nice chopping
