CATH Domain: 3ce9A01

3ce9A01

PDB 3ce9, Chain A, Domain 1

CATH Code	Level Description	Links
3	Alpha Beta
3.40	3-Layer(aba) Sandwich
3.40.50	Rossmann fold
3.40.50.1970		Gene3D
3.40.50.1970.6
3.40.50.1970.6.1
3.40.50.1970.6.1.1
3.40.50.1970.6.1.1.1
3.40.50.1970.6.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 3ce9A01

Domain	Start PDB Residue	Stop PDB Residue
3ce9A01	5	159
3ce9A02	160	353

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.50.1970.6.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1bykA02	75.09	Specific transcriptional repressor activityLacI family transcriptional regulator, trehalose operon repressorSequence-specific DNA binding transcription factor activityTranscriptionHTH-type transcriptional regulator treR	3.40.50.2300	117	11	70	3.14	4.45

[top]
Domain ATOM Sequence

>pdb|3ce9A01
SHRIAIPLILEVGNNKIYNIGQIIKKGNFKRVSLYFGEGIYELFGETIEKSIKSSNIEIEAVETVKNIDFDEIGTNAFKI
PAEVDALIGIGGGKAIDAVKYAFLRKLPFISVPTSTSNDGFSSPVASLLINGKRTSVPAKTPDGIVVDIDVIKG

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|3ce9A01
GXKGISHRIAIPLILEVGNNKIYNIGQIIKKGNFKRVSLYFGEGIYELFGETIEKSIKSSNIEIEAVETVKNIDFDEIGT
NAFKIPAEVDALIGIGGGKAIDAVKYXAFLRKLPFISVPTSTSNDGFSSPVASLLINGKRTSVPAKTPDGIVVDIDVIKG

BLAST against CATH

[top]
Domain History Events (59)

Domain assigned by cuff on 30 Mar 2009 19:21

homology match

Domain assignment manual match h by cuff on 30 Mar 2009 19:18

same superfamily

Homcheck allotment by cuff on 30 Mar 2009 19:15

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 30 Mar 2009 19:15

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 18:53

Domain "3ce9A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 18:52

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3ce9A01

Flow stage update by auto on 19 Mar 2009 16:10

Retrieved PRC_PFAMCATH results for job ID SID0538314998957696 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 16:10

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 165 results for 3ce9A01

Update comment by auto on 08 Mar 2009 06:27

PRC_PFAMCATH job SID0538314998957696 is not yet finished.

Prc pfamcath submit by auto on 08 Mar 2009 06:09

The entry "3ce9A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Mar 2009 06:09

The entry "3ce9A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Mar 2009 04:45

Retrieved SSAP results for job ID SID1382361504178944 and results inserted.

Domain scan ssap cath by auto on 08 Mar 2009 04:38

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2198 results for 3ce9A01

Update comment by auto on 04 Mar 2009 09:21

SSAP job SID1382361504178944 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 09:03

The entry "3ce9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 09:03

The entry "3ce9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:06

Retrieved PRC results for job ID SID3037592999645201 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 08:06

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 9 results for 3ce9A01

Prc cath submit by auto on 04 Mar 2009 06:22

The entry "3ce9A01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 06:22

The entry "3ce9A01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:15

Retrieved HMM(SAM) results for job ID SID5844920135476736 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:14

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 6 results for 3ce9A01