CATH Domain: 3ce9A01 XML data for domain: 3ce9A01

Molscript image for 3ce9A01
3ce9A01
PDB coordinates for domain 3ce9A01

PDB 3ce9, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1970 Gene3D
3.40.50.1970.6
3.40.50.1970.6.1
3.40.50.1970.6.1.1
3.40.50.1970.6.1.1.1
3.40.50.1970.6.1.1.1.1

Segment boundaries for domain 3ce9A01

Chopping figure for domain 3ce9A01
DomainStart PDB ResidueStop PDB Residue
3ce9A01 5 159
3ce9A02 160 353

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.50.1970.6.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1bykA02 75.09 Specific transcriptional repressor activityLacI family transcriptional regulator, trehalose operon repressorSequence-specific DNA binding transcription factor activityTranscriptionHTH-type transcriptional regulator treR 3.40.50.2300 117 11 70 3.14 4.45
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|3ce9A01
SHRIAIPLILEVGNNKIYNIGQIIKKGNFKRVSLYFGEGIYELFGETIEKSIKSSNIEIEAVETVKNIDFDEIGTNAFKI
PAEVDALIGIGGGKAIDAVKYAFLRKLPFISVPTSTSNDGFSSPVASLLINGKRTSVPAKTPDGIVVDIDVIKG    

Domain COMBS Sequence

>pdb|3ce9A01
GXKGISHRIAIPLILEVGNNKIYNIGQIIKKGNFKRVSLYFGEGIYELFGETIEKSIKSSNIEIEAVETVKNIDFDEIGT
NAFKIPAEVDALIGIGGGKAIDAVKYXAFLRKLPFISVPTSTSNDGFSSPVASLLINGKRTSVPAKTPDGIVVDIDVIKG    

Domain History Events (59)

Domain assigned by cuff on 30 Mar 2009 19:21

homology match

Domain assignment manual match h by cuff on 30 Mar 2009 19:18

same superfamily

Homcheck allotment by cuff on 30 Mar 2009 19:15

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 30 Mar 2009 19:15

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 18:53

Domain "3ce9A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 18:52

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3ce9A01

Flow stage update by auto on 19 Mar 2009 16:10

Retrieved PRC_PFAMCATH results for job ID SID0538314998957696 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 16:10

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 165 results for 3ce9A01

Update comment by auto on 08 Mar 2009 06:27

PRC_PFAMCATH job SID0538314998957696 is not yet finished.

Prc pfamcath submit by auto on 08 Mar 2009 06:09

The entry "3ce9A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Mar 2009 06:09

The entry "3ce9A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Mar 2009 04:45

Retrieved SSAP results for job ID SID1382361504178944 and results inserted.

Domain scan ssap cath by auto on 08 Mar 2009 04:38

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2198 results for 3ce9A01

Update comment by auto on 04 Mar 2009 09:21

SSAP job SID1382361504178944 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 09:03

The entry "3ce9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 09:03

The entry "3ce9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:06

Retrieved PRC results for job ID SID3037592999645201 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 08:06

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 9 results for 3ce9A01

Prc cath submit by auto on 04 Mar 2009 06:22

The entry "3ce9A01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 06:22

The entry "3ce9A01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:15

Retrieved HMM(SAM) results for job ID SID5844920135476736 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:14

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 6 results for 3ce9A01

Update comment by auto on 04 Mar 2009 01:16

HMM(SAM) job SID5844920135476736 is not yet finished.

Sam cath submit by auto on 03 Mar 2009 23:50

The entry "3ce9A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:50

The entry "3ce9A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:08

Unable to retrieve "3ce9A01" HMM(SAM) results for job "SID7600856468271304"

Update comment by auto on 19 Feb 2009 08:42

HMM(SAM) job SID7600856468271304 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:17

The entry "3ce9A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:17

The entry "3ce9A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:24

Unable to retrieve "3ce9A01" HMM(SAM) results for job "SID8237754423190000"

Update comment by auto on 22 Jan 2009 17:52

HMM(SAM) job SID8237754423190000 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:36

The entry "3ce9A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:36

The entry "3ce9A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 15:09

Unable to retrieve "3ce9A01" HMM(SAM) results for job "SID2784400073186416"

Update comment by auto on 03 Dec 2008 11:09

HMM(SAM) job SID2784400073186416 is not yet finished.

Sam cath submit by auto on 03 Dec 2008 10:58

The entry "3ce9A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:58

The entry "3ce9A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:22

Retrieved "3ce9A01" CATHEDRAL results for job ID SID8192964242410896 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Dec 2008 10:21

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 476 results for 3ce9A01

Update comment by auto on 03 Dec 2008 01:02

"3ce9A01" CATHEDRAL job SID8192964242410896 is not yet finished.

Cathedral cath submit by auto on 03 Dec 2008 00:27

The entry "3ce9A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Dec 2008 00:27

The entry "3ce9A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 02 Dec 2008 23:54

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3ce9A01.scanlist" for "3ce9A01"

Write scan list by auto on 02 Dec 2008 23:53

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3ce9A01.scanlist" for domain "3ce9A01"

Update comment by auto on 02 Dec 2008 21:06

Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 17:28

Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 15:14

Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 11:26

Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 10:46

Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 23:28

Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 21:05

Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 18:09

Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 14:31

Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Dec 2008 14:30

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Dec 2008 14:09

No in_process hits for Domain "3ce9A01" ready to be processed

Flow stage update by auto on 01 Dec 2008 14:09

NW result present for Domain "3ce9A01"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3ce9A01"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3ce9A01"

Insertion by cuff on 27 Nov 2008 16:55

nice chopping