CATH Domain: 3ce8A00 XML data for domain: 3ce8A00

Molscript image for 3ce8A00
3ce8A00
PDB coordinates for domain 3ce8A00

PDB 3ce8, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.70 Alpha-Beta Plaits
3.30.70.120 Gene3D
3.30.70.120.3
3.30.70.120.3.1
3.30.70.120.3.1.1
3.30.70.120.3.1.1.1
3.30.70.120.3.1.1.1.1

[top]
Segment boundaries for domain 3ce8A00

Chopping figure for domain 3ce8A00
DomainStart PDB ResidueStop PDB Residue
3ce8A00 2 101

Structural Neighbourhood (57 entries)

There are 57 matching structural neighberhood comparisons for CATH ID 3.30.70.120.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 57 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2gx8C02 86.16 Bacillus cereus ATCC 14579NIF3-related protein 3.30.70.830 102 12 85 2.82 3.31
2vd3A03 85.01 Methanothermobacter thermautotrophicus str. Delta HATP phosphoribosyltransferaseATP phosphoribosyltransferase [EC:2.4.2.17]Histidine metabolismMetabolic pathways 3.30.70.120 74 12 81 2.06 2.52
1nzaA00 84.77 Thermus thermophilus HB8Divalent-cation tolerance protein cutAPeriplasmic divalent cation tolerance protein 3.30.70.830 103 9 83 2.38 2.85
2nuhA00 84.44 Xylella fastidiosaPeriplasmic divalent cation tolerance proteinPeriplasmic divalent cation tolerance protein 3.30.70.830 104 11 83 2.42 2.89
1vi7A02 84.15 IMPACT family member yigZProtein bindingEscherichia coli K-12 3.30.70.240 71 14 80 3.01 3.74
1darA05 84.05 Thermus thermophilus HB8Elongation factor GElongation factor EF-G [EC:3.6.5.3] 3.30.70.240 87 6 88 4.13 4.67
1nh8A03 83.40 Histidine metabolismMetabolic pathwaysATP phosphoribosyltransferaseATP phosphoribosyltransferase [EC:2.4.2.17]Mycobacterium tuberculosis 3.30.70.120 67 7 75 2.53 3.33
1u8sA02 83.08 Glycine cleavage system transcriptional repressor, putativeGlycine cleavage system transcriptional repressorVibrio cholerae 3.30.70.260 84 4 86 3.11 3.61
1y7pB01 82.96 Archaeoglobus fulgidusUncharacterized protein AF_1403 3.30.70.260 80 10 86 3.09 3.58
1u8sA01 82.79 Glycine cleavage system transcriptional repressor, putativeGlycine cleavage system transcriptional repressorVibrio cholerae 3.30.70.260 86 13 90 3.67 4.04
2f1fA01 82.75 Valine, leucine and isoleucine biosynthesisMetabolic pathwaysButanoate metabolismC5-Branched dibasic acid metabolismPantothenate and CoA biosynthesis 3.30.70.260 79 6 83 3.33 3.97
1q5yD00 82.41 CopG family transcriptional regulator, nickel-responsive regulatorNickel-responsive regulatorProtein bindingEscherichia coli K-12 3.30.70.1150 80 7 86 3.55 4.12
2nzcA00 82.37 Thermotoga maritimaPutative uncharacterized protein 3.30.70.1150 77 9 82 3.35 4.05
1jqgA01 81.43 Carboxypeptidase AHelicoverpa armigera 3.30.70.340 91 9 79 3.48 4.40
1xmbA02 80.90 Auxin metabolic processArabidopsis thalianaIAA-Ala conjugate hydrolase activityIAA-amino acid hydrolase ILR1-like 2 3.30.70.360 101 5 71 2.85 4.00
2anrA01 80.66 RNA-binding protein Nova-1Synaptic transmissionHomo sapiensLocomotory behavior 3.30.1370.10 79 11 78 3.81 4.87
1u7lA01 80.50 V-type H+-transporting ATPase subunit C [EC:3.6.3.14]Oxidative phosphorylationVacuolar acidificationProtein bindingVacuolar proton-transporting V-type ATPase, V1 domain 3.30.70.1180 91 6 79 2.61 3.30
1earA02 80.21 Sporosarcina pasteuriiUrease accessory protein ureE 3.30.70.790 69 8 75 3.62 4.77
1zpvB00 79.90 ACT domain-containing proteinUPF0237 protein SP_0238Streptococcus pneumoniae 3.30.70.260 81 6 83 3.86 4.60
2nyiA01 79.73 3.30.70.260 77 10 85 3.43 4.03
1kr4A00 79.73 Thermotoga maritimaDivalent-cation tolerance protein cutAPeriplasmic divalent cation tolerance protein 3.30.70.830 107 11 78 3.18 4.05
2anrA02 79.25 RNA-binding protein Nova-1Synaptic transmissionHomo sapiensLocomotory behavior 3.30.1370.10 74 10 74 3.23 4.32
1xtzA02 79.06 Identical protein bindingNucleusRibose-5-phosphate isomerasePyridoxine biosynthetic processRibose 5-phosphate isomerase A [EC:5.3.1.6] 3.30.70.260 84 5 80 3.24 4.03
2i0xA01 78.96 Pyrococcus furiosusPutative uncharacterized protein 3.30.70.240 66 13 74 3.24 4.34
2w25A02 78.80 Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory proteinLeucine-responsive regulatory proteinMycobacterium tuberculosis 3.30.70.920 81 11 75 3.21 4.23
1konA03 78.70 UPF0082 protein yebCEscherichia coli K-12 3.30.70.980 75 8 78 3.38 4.32
2rhsD06 78.62 Aminoacyl-tRNA biosynthesisStaphylococcus haemolyticus JCSC1435Phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]Phenylalanyl-tRNA synthetase beta chain 3.30.70.380 88 8 80 3.65 4.52
1zzkA00 78.60 SpliceosomeHeterogeneous nuclear ribonucleoprotein KRNA bindingHeterogeneous nuclear ribonucleoprotein KProtein binding 3.30.1370.10 80 10 77 3.33 4.32
1mw7A03 78.46 Helicobacter pyloriUPF0082 protein HP_0162 3.30.70.980 75 10 78 3.55 4.54
1eayD00 78.46 Bacterial chemotaxisTwo-component systemTwo-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]Escherichia coli K-12Chemotaxis protein cheA 3.30.70.400 69 8 78 3.50 4.48
3c19A01 78.40 Methanopyrus kandleriUncharacterized conserved protein 3.30.70.1380 98 8 80 3.60 4.47
2pd1A01 78.39 Nitrosomonas europaeaPutative uncharacterized protein 3.30.70.900 93 11 76 2.95 3.86
2bbeA00 78.35 Shewanella oneidensisPutative uncharacterized protein 3.30.70.900 92 4 82 3.38 4.09
2qmxA03 78.12 Prephenate dehydratase [EC:4.2.1.51]Phenylalanine, tyrosine and tryptophan biosynthesisChlorobaculum tepidumMetabolic pathwaysPrephenate dehydratase 3.30.70.260 90 8 88 4.00 4.50
1dtjA00 78.06 RNA-binding protein Nova-2Homo sapiens 3.30.1370.10 74 10 75 2.99 3.94
1iujB00 78.03 TT1380 proteinThermus thermophilus 3.30.70.900 103 2 75 3.47 4.58
1lfpA03 77.85 UPF0082 protein aq_1575Aquifex aeolicus 3.30.70.980 73 8 80 3.39 4.21
1x7vC00 77.56 Pseudomonas aeruginosaPutative uncharacterized protein 3.30.70.900 97 9 77 3.76 4.86
1in0A01 77.55 Hypothetical proteinHaemophilus influenzaeUPF0234 protein HI_1034 3.30.70.860 70 5 78 3.33 4.26
2j8sA03 77.19 Hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 familyAcriflavine resistance protein BProtein bindingEscherichia coli K-12 3.30.70.1320 100 13 75 3.32 4.43
2qmwA03 76.61 Phenylalanine, tyrosine and tryptophan biosynthesisMetabolic pathwaysPrephenate dehydratase [EC:4.2.1.51]Similar to chorismate mutaseStaphylococcus aureus subsp. aureus Mu50 3.30.70.260 73 5 78 3.24 4.15
1s99A02 76.46 Bacillus subtilisPutative HMP/thiamine-binding protein ykoF 3.30.70.930 81 9 82 3.90 4.71
1mlaA01 76.46 Fatty acid biosynthesisMetabolic pathwaysMalonyl CoA-acyl carrier protein transacylase[acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]Escherichia coli K-12 3.30.70.250 73 8 77 3.22 4.18
1yx2A02 76.39 Nitrogen metabolismAminomethyltransferase [EC:2.1.2.10]One carbon pool by folateBacillus subtilisGlycine, serine and threonine metabolism 3.30.70.1400 81 2 71 3.25 4.56
1kn6A00 76.09 Mus musculusPeptide hormone processingSerine-type endopeptidase activityNeuroendocrine convertase 1Proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93] 3.30.70.850 73 4 75 3.05 4.02
1v8cA02 75.97 Threonine synthaseThermus thermophilus 3.30.1370.80 80 5 77 3.77 4.90
2u1aA00 75.92 U1 small nuclear ribonucleoprotein ASpliceosomeSpliceosomal complexHomo sapiensProtein binding 3.30.70.330 88 8 81 3.63 4.44
1lfwA03 75.92 Lactobacillus delbrueckii subsp. lactisBeta-Ala-Xaa dipeptidase 3.30.70.360 88 11 69 3.07 4.43
1j4wA01 75.73 Transcription from RNA polymerase II promoterFar upstream element-binding proteinSequence-specific DNA binding transcription factor activityFar upstream element-binding protein 1Nucleus 3.30.1370.10 74 1 74 3.72 4.98
1wj9A01 75.57 Thermus thermophilus HB8Putative uncharacterized protein TTHB192 3.30.70.1200 87 9 78 3.46 4.43
1utaA00 75.39 Membrane fractionCell cycle cytokinesisCell division protein FtsNCell division protein ftsNProtein binding 3.30.70.1070 77 6 77 3.67 4.77
1qm9A02 74.98 Polypyrimidine tract-binding protein 1Poly-pyrimidine tract bindingHeterogeneous nuclear ribonucleoprotein complexMRNA processingNucleolus 3.30.70.330 89 8 83 4.01 4.82
1j27A00 74.94 Hypothetical proteinThermus thermophilusPutative uncharacterized protein 3.30.70.1120 98 8 78 3.72 4.73
2axyA00 74.85 Poly(rC)-binding protein 2CytoplasmRNA bindingHomo sapiensProtein binding 3.30.1370.10 69 5 72 3.61 4.99
2fiuA00 73.90 Agrobacterium tumefaciens str. C58Putative uncharacterized protein 3.30.70.900 93 9 83 3.80 4.53
3dnjB00 73.78 ATP-dependent Clp protease adaptor protein ClpSCaulobacter vibrioidesATP-dependent Clp protease adapter protein clpS 3.30.1390.10 75 6 77 3.79 4.92
1nm2A01 72.16 Fatty acid biosynthesisStreptomyces coelicolorMalonyl CoA:acyl carrier protein malonyltransferase[acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]Metabolic pathways 3.30.70.250 68 10 71 3.43 4.81
[1]
Displaying entries 1 to 57 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3ce8A00
STEQLLVLIAQNDIKDDIVDTLIELEFLSGFSLGNICGFSREGYREFCKFEIHPAAQQAALLTALALVCKHNPCRYWIPI
YQNGTLS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3ce8A00
STEQLLVLIAQNDIKDDIVDTLIELEFLSGFSLGNICGFSREHSHFNIKEQVEGYREFCKFEIXHPAAQQAALLTALALV
CKHNPCRYWIXPIYQNGTLS
BLAST against CATH

[top]
Domain History Events (59)

Domain assigned by cuff on 30 Mar 2009 19:15

same superfamily

Domain assignment manual match h by cuff on 30 Mar 2009 19:14

same superfamily

Homcheck allotment by cuff on 30 Mar 2009 19:12

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 30 Mar 2009 19:12

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 18:49

Domain "3ce8A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 18:49

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3ce8A00

Flow stage update by auto on 19 Mar 2009 16:05

Retrieved PRC_PFAMCATH results for job ID SID8407279950208384 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 16:04

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 2 results for 3ce8A00

Update comment by auto on 07 Mar 2009 16:32

PRC_PFAMCATH job SID8407279950208384 is not yet finished.

Prc pfamcath submit by auto on 07 Mar 2009 16:18

The entry "3ce8A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Mar 2009 16:18

The entry "3ce8A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Mar 2009 16:07

Retrieved SSAP results for job ID SID0315711117247008 and results inserted.

Domain scan ssap cath by auto on 07 Mar 2009 15:58

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 4220 results for 3ce8A00

Update comment by auto on 04 Mar 2009 09:21

SSAP job SID0315711117247008 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 09:03

The entry "3ce8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 09:03

The entry "3ce8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 08:04

Retrieved PRC results for job ID SID0697554311109736 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 08:03

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 3ce8A00

Prc cath submit by auto on 04 Mar 2009 06:21

The entry "3ce8A00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 06:21

The entry "3ce8A00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:12

Retrieved HMM(SAM) results for job ID SID6863458290986752 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:11

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3ce8A00

Update comment by auto on 04 Mar 2009 01:16

HMM(SAM) job SID6863458290986752 is not yet finished.

Sam cath submit by auto on 03 Mar 2009 23:49

The entry "3ce8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:49

The entry "3ce8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:08

Unable to retrieve "3ce8A00" HMM(SAM) results for job "SID1127018554747976"

Update comment by auto on 19 Feb 2009 08:42

HMM(SAM) job SID1127018554747976 is not yet finished.

Flow stage update by auto on 19 Feb 2009 08:16

The entry "3ce8A00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 19 Feb 2009 08:16

The entry "3ce8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:24

Unable to retrieve "3ce8A00" HMM(SAM) results for job "SID7922674748380624"

Update comment by auto on 22 Jan 2009 17:52

HMM(SAM) job SID7922674748380624 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:36

The entry "3ce8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:36

The entry "3ce8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 15:09

Unable to retrieve "3ce8A00" HMM(SAM) results for job "SID6604165698766944"

Update comment by auto on 03 Dec 2008 11:09

HMM(SAM) job SID6604165698766944 is not yet finished.

Flow stage update by auto on 03 Dec 2008 10:58

The entry "3ce8A00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Dec 2008 10:58

The entry "3ce8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:18

Retrieved "3ce8A00" CATHEDRAL results for job ID SID1557761729568516 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Dec 2008 10:17

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 196 results for 3ce8A00

Update comment by auto on 03 Dec 2008 01:01

"3ce8A00" CATHEDRAL job SID1557761729568516 is not yet finished.

Flow stage update by auto on 03 Dec 2008 00:27

The entry "3ce8A00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Dec 2008 00:27

The entry "3ce8A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 02 Dec 2008 23:53

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3ce8A00.scanlist" for "3ce8A00"

Write scan list by auto on 02 Dec 2008 23:53

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3ce8A00.scanlist" for domain "3ce8A00"

Update comment by auto on 02 Dec 2008 21:06

Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 17:28

Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 15:14

Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 11:26

Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 10:46

Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 23:28

Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 21:05

Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 18:09

Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 14:31

Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Dec 2008 14:30

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Dec 2008 14:09

No in_process hits for Domain "3ce8A00" ready to be processed

Flow stage update by auto on 01 Dec 2008 14:09

NW result present for Domain "3ce8A00"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3ce8A00"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3ce8A00"

Insertion by cuff on 27 Nov 2008 16:55

nice chopping