CATH Domain: 3ccgA00 XML data for domain: 3ccgA00

Molscript image for 3ccgA00
3ccgA00
PDB coordinates for domain 3ccgA00

PDB 3ccg, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.3210 Hypothetical protein af1432
1.10.3210.10 Hypothetical protein af1432 Gene3D
1.10.3210.10.2
1.10.3210.10.2.1
1.10.3210.10.2.1.1
1.10.3210.10.2.1.1.1
1.10.3210.10.2.1.1.1.1

[top]
Segment boundaries for domain 3ccgA00

Chopping figure for domain 3ccgA00
DomainStart PDB ResidueStop PDB Residue
3ccgA00 0 188

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.3210.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ogiB00 91.45 Streptococcus agalactiae serogroup VPutative uncharacterized protein 1.10.3210.10 189 34 94 1.54 1.64
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3ccgA00
GWSYDKITDYLNNLGEKRYKHSLGVDTAVRLAGIYNEDTEKARIAGLVHDCAKKLPGEKIIEICTNEGYELGDEDIRNSY
LLHGLAGRILAKKVIGIDDEDVLNAIEFHTTGRPNSLLEKIIYIADYIEPGREFKGVDELRKAADEDLNKALLSFDNTIK
FVIDKGGFLHHNTIEARNYLISRK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3ccgA00
GXWSYDKITDYLXNNLGEKRYKHSLGVXDTAVRLAGIYNEDTEKARIAGLVHDCAKKLPGEKIIEICTNEGYELGDEDIR
NSYLLHGLAGRILAKKVIGIDDEDVLNAIEFHTTGRPNXSLLEKIIYIADYIEPGREFKGVDELRKAADEDLNKALLXSF
DNTIKFVIDKGGFLHHNTIEARNYLISRKG
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 17 Oct 2008 15:32

Assigning to "1.10.3210.10" based on similarity with "2o08A00"

Flow stage update by auto on 17 Oct 2008 15:27

No in_process hits for Domain "3ccgA00" ready to be processed

Update comment by auto on 17 Oct 2008 15:10

Domain "3ccgA00" hits Domain "2o08B00" (40.4255319148936% over 98.9473684210526%) which is currently in process

Update comment by auto on 23 Jul 2008 18:01

Domain "3ccgA00" hits Domain "2o08A00" (40.4255319148936% over 98.9473684210526%) which is currently in process

Update comment by auto on 15 Mar 2008 20:15

Domain "3ccgA00" hits Domain "2o08A00" (40.4255319148936% over 98.9473684210526%) which is currently in process

Flow stage update by auto on 15 Mar 2008 20:05

Domain "3ccgA00" hits Domain "2o08A00" (40.4255319148936% over 98.9473684210526%) which is currently in process

Flow stage update by auto on 15 Mar 2008 20:05

NW result present for Domain "3ccgA00"

Flow stage update by auto on 15 Mar 2008 08:07

All required files are present for Domain "3ccgA00"

Flow stage update by auto on 14 Mar 2008 20:15

Beginning processing for Domain "3ccgA00"

Insertion by auto on 14 Mar 2008 20:08

Final ChopClose added based on similarity with "2o08A"