Domain assigned by cuff on 30 Mar 2009 14:36
same superfamily
There are 10 matching structural neighberhood comparisons for CATH ID 3.40.50.150.18.1.1.1.1 (SIMAX score < 5)
>pdb|3cc8A00 AVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETDPYEEEQFDCVIFGD VLEHLFDPWAVIEKVKPYIKQNGVILASIPNVSHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNELRFLKAGYSISKVD RVYVDHKYEPLIEELYGICKKYRLGSGFAETVVFQYIIEAEKSQL
same superfamily
homology match
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "3cc8A00" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cc8A00
Retrieved PRC_PFAMCATH results for job ID SID1407468926353520 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 3968 results for 3cc8A00
PRC_PFAMCATH job SID1407468926353520 is not yet finished.
The entry "3cc8A00" has been submitted to the PRC_PFAMCATH webservice.
The entry "3cc8A00" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID1907230139581767 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1548 results for 3cc8A00
SSAP job SID1907230139581767 is not yet finished.
The entry "3cc8A00" has been submitted to the SSAP webservice.
The entry "3cc8A00" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID7044594730903298 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 101 results for 3cc8A00
The entry "3cc8A00" has been submitted to the PRC webservice.
The entry "3cc8A00" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID3595784364880352 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 76 results for 3cc8A00
HMM(SAM) job SID3595784364880352 is not yet finished.
The entry "3cc8A00" has been submitted to the HMM (SAM) webservice.
The entry "3cc8A00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "3cc8A00" HMM(SAM) results for job "SID1676749568037312"
HMM(SAM) job SID1676749568037312 is not yet finished.
The entry "3cc8A00" has been submitted to the HMM (SAM) webservice.
The entry "3cc8A00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "3cc8A00" HMM(SAM) results for job "SID3079161677313920"
HMM(SAM) job SID3079161677313920 is not yet finished.
The entry "3cc8A00" has been submitted to the HMM (SAM) webservice.
The entry "3cc8A00" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "3cc8A00" HMM(SAM) results for job "SID2282109556020704"
HMM(SAM) job SID2282109556020704 is not yet finished.
The entry "3cc8A00" has been submitted to the HMM (SAM) webservice.
The entry "3cc8A00" has been submitted to the HMM (SAM) webservice.
Retrieved "3cc8A00" CATHEDRAL results for job ID SID3503455497844920 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 466 results for 3cc8A00
"3cc8A00" CATHEDRAL job SID3503455497844920 is not yet finished.
The entry "3cc8A00" has been submitted to the CATHEDRAL webservice.
The entry "3cc8A00" has been submitted to the CATHEDRAL webservice.
ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3cc8A00.scanlist" for "3cc8A00"
Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3cc8A00.scanlist" for domain "3cc8A00"
Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.
Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.
Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.
Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.
Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.
Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.
Waiting for 309 new domains (example : 3cdxD00) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "3cc8A00" ready to be processed
NW result present for Domain "3cc8A00"
All required files are present for Domain "3cc8A00"
Beginning processing for Domain "3cc8A00"
nice chopping