CATH Domain: 3cc8A00 XML data for domain: 3cc8A00

Molscript image for 3cc8A00
3cc8A00
PDB coordinates for domain 3cc8A00

PDB 3cc8, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.150 Vaccinia Virus protein VP39 Gene3D
3.40.50.150.18
3.40.50.150.18.1
3.40.50.150.18.1.1
3.40.50.150.18.1.1.1
3.40.50.150.18.1.1.1.1

Segment boundaries for domain 3cc8A00

Chopping figure for domain 3cc8A00
DomainStart PDB ResidueStop PDB Residue
3cc8A00 19 229

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.40.50.150.18.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2r3sA03 80.63 3.40.50.150 202 19 79 3.53 4.44
2o57A02 80.08 3.40.50.150 160 15 67 2.60 3.86
1xvaA02 79.89 S-adenosylhomocysteine metabolic processRattus norvegicusNucleusGlycine, serine and threonine metabolismGlycine N-methyltransferase activity 3.40.50.150 188 12 75 3.70 4.89
3bxoA01 79.86 Streptomyces venezuelaeN,N-dimethyltransferase 3.40.50.150 177 12 70 2.87 4.06
1g8aA02 78.56 Pyrococcus horikoshiiFibrillarin-like rRNA/tRNA 2'-O-methyltransferaseFibrillarin-like pre-rRNA processing protein 3.40.50.150 176 11 69 2.94 4.21
1dusA00 77.75 Methanocaldococcus jannaschiiProtein MJ0882 3.40.50.150 192 13 69 2.61 3.77
1i9gA02 77.68 POSSIBLE RNA METHYLTRANSFERASETRNA (adenine-N1-)-methyltransferase [EC:2.1.1.36]Mycobacterium tuberculosis 3.40.50.150 184 12 71 3.10 4.35
2ozvA01 77.51 Agrobacterium tumefaciens str. C58Putative uncharacterized protein 3.40.50.150 190 12 68 2.88 4.19
2fpoC00 77.47 Ribosomal RNA small subunit methyltransferase D [EC:2.1.1.52]RRNA (guanine-N2-)-methyltransferase activityRRNA base methylationProtein bindingEscherichia coli K-12 3.40.50.150 176 11 66 2.95 4.41
1ne2B00 76.41 Putative uncharacterized protein Ta1320Putative methylaseThermoplasma acidophilum 3.40.50.150 180 14 68 3.10 4.51
Displaying entries 1 to 10 (page 1 of 1)


Domain ATOM Sequence

>pdb|3cc8A00
AVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETDPYEEEQFDCVIFGD
VLEHLFDPWAVIEKVKPYIKQNGVILASIPNVSHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNELRFLKAGYSISKVD
RVYVDHKYEPLIEELYGICKKYRLGSGFAETVVFQYIIEAEKSQL    

Domain COMBS Sequence

>pdb|3cc8A00
AVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETXDXPYEEEQFDCVIF
GDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVSHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEXLRXFLKAGYSI
SKVDRVYVDHKXYEPLIEELYGICKKYRLGSGFXAETVVFQYIIEAEKSQL    

Domain History Events (60)

Domain assigned by cuff on 30 Mar 2009 14:36

same superfamily

Domain assignment manual match h by cuff on 30 Mar 2009 14:35

homology match

Homcheck allotment by cuff on 30 Mar 2009 14:29

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 30 Mar 2009 14:29

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Mar 2009 18:44

Domain "3cc8A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Mar 2009 18:43

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3cc8A00

Flow stage update by auto on 19 Mar 2009 15:58

Retrieved PRC_PFAMCATH results for job ID SID1407468926353520 and results inserted.

Domain scan prc pfamcath by auto on 19 Mar 2009 15:56

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 3968 results for 3cc8A00

Update comment by auto on 07 Mar 2009 22:56

PRC_PFAMCATH job SID1407468926353520 is not yet finished.

Flow stage update by auto on 07 Mar 2009 22:44

The entry "3cc8A00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 07 Mar 2009 22:44

The entry "3cc8A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Mar 2009 22:27

Retrieved SSAP results for job ID SID1907230139581767 and results inserted.

Domain scan ssap cath by auto on 07 Mar 2009 22:24

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1548 results for 3cc8A00

Update comment by auto on 04 Mar 2009 09:20

SSAP job SID1907230139581767 is not yet finished.

Ssap cath submit by auto on 04 Mar 2009 09:02

The entry "3cc8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 09:02

The entry "3cc8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 04 Mar 2009 07:58

Retrieved PRC results for job ID SID7044594730903298 and inserted them into the database.

Domain scan prc cath by auto on 04 Mar 2009 07:58

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 101 results for 3cc8A00

Flow stage update by auto on 04 Mar 2009 06:20

The entry "3cc8A00" has been submitted to the PRC webservice.

Prc cath submit by auto on 04 Mar 2009 06:20

The entry "3cc8A00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Mar 2009 05:07

Retrieved HMM(SAM) results for job ID SID3595784364880352 and inserted them into the database.

Domain scan sam cath by auto on 04 Mar 2009 05:07

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 76 results for 3cc8A00

Update comment by auto on 04 Mar 2009 01:15

HMM(SAM) job SID3595784364880352 is not yet finished.

Sam cath submit by auto on 03 Mar 2009 23:48

The entry "3cc8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:48

The entry "3cc8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:07

Unable to retrieve "3cc8A00" HMM(SAM) results for job "SID1676749568037312"

Update comment by auto on 19 Feb 2009 08:42

HMM(SAM) job SID1676749568037312 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 08:15

The entry "3cc8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 08:15

The entry "3cc8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Jan 2009 12:23

Unable to retrieve "3cc8A00" HMM(SAM) results for job "SID3079161677313920"

Update comment by auto on 22 Jan 2009 17:52

HMM(SAM) job SID3079161677313920 is not yet finished.

Sam cath submit by auto on 22 Jan 2009 17:35

The entry "3cc8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2009 17:35

The entry "3cc8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 15:08

Unable to retrieve "3cc8A00" HMM(SAM) results for job "SID2282109556020704"

Update comment by auto on 03 Dec 2008 11:08

HMM(SAM) job SID2282109556020704 is not yet finished.

Sam cath submit by auto on 03 Dec 2008 10:57

The entry "3cc8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:57

The entry "3cc8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Dec 2008 10:07

Retrieved "3cc8A00" CATHEDRAL results for job ID SID3503455497844920 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Dec 2008 10:05

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 466 results for 3cc8A00

Update comment by auto on 03 Dec 2008 01:00

"3cc8A00" CATHEDRAL job SID3503455497844920 is not yet finished.

Flow stage update by auto on 03 Dec 2008 00:25

The entry "3cc8A00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Dec 2008 00:25

The entry "3cc8A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 02 Dec 2008 23:51

ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3cc8A00.scanlist" for "3cc8A00"

Write scan list by auto on 02 Dec 2008 23:51

Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3cc8A00.scanlist" for domain "3cc8A00"

Update comment by auto on 02 Dec 2008 21:06

Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 17:28

Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 15:14

Waiting for 147 new domains (example : 2r6gF01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 11:26

Waiting for 204 new domains (example : 2j7aI00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2008 10:46

Waiting for 279 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 23:28

Waiting for 310 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 21:05

Waiting for 358 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 18:09

Waiting for 396 new domains (example : 2ar0A01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 14:31

Waiting for 256 new domains (example : 3cfuB00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2008 11:55

Waiting for 309 new domains (example : 3cdxD00) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Dec 2008 11:24

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Dec 2008 11:07

No in_process hits for Domain "3cc8A00" ready to be processed

Flow stage update by auto on 01 Dec 2008 11:07

NW result present for Domain "3cc8A00"

Flow stage update by auto on 28 Nov 2008 11:14

All required files are present for Domain "3cc8A00"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3cc8A00"

Insertion by cuff on 27 Nov 2008 16:55

nice chopping